KEGG   Piliocolobus tephrosceles (Ugandan red Colobus): 111525629
Entry
111525629         CDS       T07491                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
pteh  Piliocolobus tephrosceles (Ugandan red Colobus)
Pathway
pteh04610  Complement and coagulation cascades
pteh04810  Regulation of actin cytoskeleton
pteh05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pteh00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111525629 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111525629 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111525629 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pteh04515]
    111525629 (ITGAX)
   04090 CD molecules [BR:pteh04090]
    111525629 (ITGAX)
Cell adhesion molecules [BR:pteh04515]
 Integrins
  Integrin alpha subunits
   111525629 (ITGAX)
CD molecules [BR:pteh04090]
 Proteins
  111525629 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 111525629
NCBI-ProteinID: XP_023046844
Ensembl: ENSPTEG00000028262
LinkDB
Position
17:29006236..29035808
AA seq 1154 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAATTSPPQLLACGPTVHHGCGRNM
YLTGLCFLLAPTQLTQRLPASGQECPRQELDIVLLIDGSGSISPGDFATMMNFVRAVISQ
FQRPSTQFSLMQFSSEFYVHFTFEKFRRTSNPLGLLASVHQLRGLTHTATAIQKVVHQLF
QASHGARGDATKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGSAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPILGAVGSFTWSGGAFLYPPNTNPTFINMSQENVDMRDSYLGYSTELALWKGVQNL
VLGAPRYQHTGKAAVFTQVSGQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENQGAVYLFHGALGPSIGPSHSQRITGSQLSPRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFKPAEIPRSAFECQEQVVSDQILGQSSICLYIDK
RSKNLLGSRDLQSSLTVDLALDPGRLSPRATFQETKNRSLSRVQVLGLQTYCETFTLLLP
TCVEDSVTPITLRLNFTLVGEPLPAFRNLRPMLAADAQRYFMASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELKAEVIVWNDGEDSYGTTITFSHPAGLSYRHVAESQKQGQ
LRSLRLTCDSAPAGSQSTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLELPLKYAVYTVASSHEQSTKYLNFSDSEEKESRVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMEVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSIQEELDFTLKGNLSFGWVRQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYEVHNPTPIIVGSSIGGLLLLALITAALYKVGFFKRQYKEM
MEEANGQIAPENGT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcgctcctcctgttcacagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccccaagagagaacagctgcc
aaccaaacgggcggcctctaccagtgcggctacagcaccggtgcctgtgagcccattggc
ctgcaggtccccccggaggctgtgaacatgtccctgggcctgtccctggcggctaccacc
agccccccccagctgctggcctgcggccccaccgtgcaccacgggtgtgggaggaacatg
tacctgaccggactctgcttcctcctggcccccacccagctcacccagaggctcccggcg
tccgggcaggagtgcccaagacaggagctggacattgtgttgctgattgatggctcgggc
agcatctcccccggcgactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccagtgaattctacgtacac
ttcacttttgagaaattcaggcgcacctcaaaccccctcggcctgttggcttctgttcac
caactgagagggttgacacacacggccactgccatccaaaaagtcgtgcaccaattgttc
caggcctcacacggggcccgtggggatgccactaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggacgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggatcagcttttcaaaacagaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccagctgaaggagaagatctttgccattgaaggtacggag
accacaagcagtagctccttcgaattggagatggcgcaggagggcttcagcgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtatcccccaaatacgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccacggagctggctctctggaaaggggtgcagaacctg
gtcctgggggccccccgctaccagcacactgggaaggctgccgtcttcacccaggtgtcc
gggcaatggaggctgaaggccgaagtcacggggacacagattggttcctacttcggggcc
tccctctgctccgtggatgtggatggcgacggcagcactgacctgatcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtccgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctccacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggacgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaagagaaccagggtgctgtctacctgtttcacggagccttg
ggacctagcatcggcccctcccacagccagcggatcaccggctcccagctctcccccagg
ctgcagtattttgggcaggcactgagcggcggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccggggccaggtgctcctgctcaggacgagacctgtgctctgg
gtaggggtgagcatgcagttcaaacctgctgagatccccaggtctgcatttgagtgtcag
gagcaggtggtctctgaccagatcctgggacaatccagcatctgcctttacattgacaaa
cgttccaagaacctgcttgggagccgtgacctccaaagctctctgaccgtggacctggct
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccaagtcctcgggctgcagacatactgtgaaaccttcaccctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
gagcccctccctgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcatggcctccctcccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcctgaagaccctgctggtggggagtaacctggag
ctgaaggcagaagtgatagtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccggcaggactgtcctaccgccatgtggcagagagccagaaacaggggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagctgggagccagagcacctggagt
accagctgcagaatcaaccacctcatcttccgtggtggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttttgacagccaatgtg
agcagtgagaacaacactcccaggacgaacaagaccaccttccagctggagctcccgctg
aagtatgccgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagagccgtgtggccatgcacagataccaggttaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcgcacccccagcatctgacttcctggcacacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgatgtgccctccttcagcatccag
gaggagctggatttcaccctgaagggcaacctcagttttggctgggtccgccagacatca
cagaagaaggtgtcagttgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacaacaacggtgctggagaagtac
gaggtccacaaccccacccccatcatcgtaggcagctccattgggggtctgctgctgctg
gcgctcatcacagcagcactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgctccagaaaacgggacatag

DBGET integrated database retrieval system