KEGG   Piliocolobus tephrosceles (Ugandan red Colobus): 111525729
Entry
111525729         CDS       T07491                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pteh  Piliocolobus tephrosceles (Ugandan red Colobus)
Pathway
pteh01521  EGFR tyrosine kinase inhibitor resistance
pteh01522  Endocrine resistance
pteh01524  Platinum drug resistance
pteh04010  MAPK signaling pathway
pteh04012  ErbB signaling pathway
pteh04014  Ras signaling pathway
pteh04015  Rap1 signaling pathway
pteh04022  cGMP-PKG signaling pathway
pteh04024  cAMP signaling pathway
pteh04062  Chemokine signaling pathway
pteh04066  HIF-1 signaling pathway
pteh04068  FoxO signaling pathway
pteh04071  Sphingolipid signaling pathway
pteh04072  Phospholipase D signaling pathway
pteh04114  Oocyte meiosis
pteh04140  Autophagy - animal
pteh04148  Efferocytosis
pteh04150  mTOR signaling pathway
pteh04151  PI3K-Akt signaling pathway
pteh04210  Apoptosis
pteh04218  Cellular senescence
pteh04261  Adrenergic signaling in cardiomyocytes
pteh04270  Vascular smooth muscle contraction
pteh04350  TGF-beta signaling pathway
pteh04360  Axon guidance
pteh04370  VEGF signaling pathway
pteh04371  Apelin signaling pathway
pteh04380  Osteoclast differentiation
pteh04510  Focal adhesion
pteh04517  IgSF CAM signaling
pteh04520  Adherens junction
pteh04540  Gap junction
pteh04550  Signaling pathways regulating pluripotency of stem cells
pteh04611  Platelet activation
pteh04613  Neutrophil extracellular trap formation
pteh04620  Toll-like receptor signaling pathway
pteh04621  NOD-like receptor signaling pathway
pteh04625  C-type lectin receptor signaling pathway
pteh04650  Natural killer cell mediated cytotoxicity
pteh04657  IL-17 signaling pathway
pteh04658  Th1 and Th2 cell differentiation
pteh04659  Th17 cell differentiation
pteh04660  T cell receptor signaling pathway
pteh04662  B cell receptor signaling pathway
pteh04664  Fc epsilon RI signaling pathway
pteh04666  Fc gamma R-mediated phagocytosis
pteh04668  TNF signaling pathway
pteh04713  Circadian entrainment
pteh04720  Long-term potentiation
pteh04722  Neurotrophin signaling pathway
pteh04723  Retrograde endocannabinoid signaling
pteh04724  Glutamatergic synapse
pteh04725  Cholinergic synapse
pteh04726  Serotonergic synapse
pteh04730  Long-term depression
pteh04810  Regulation of actin cytoskeleton
pteh04910  Insulin signaling pathway
pteh04912  GnRH signaling pathway
pteh04914  Progesterone-mediated oocyte maturation
pteh04915  Estrogen signaling pathway
pteh04916  Melanogenesis
pteh04917  Prolactin signaling pathway
pteh04919  Thyroid hormone signaling pathway
pteh04921  Oxytocin signaling pathway
pteh04926  Relaxin signaling pathway
pteh04928  Parathyroid hormone synthesis, secretion and action
pteh04929  GnRH secretion
pteh04930  Type II diabetes mellitus
pteh04933  AGE-RAGE signaling pathway in diabetic complications
pteh04934  Cushing syndrome
pteh04935  Growth hormone synthesis, secretion and action
pteh04960  Aldosterone-regulated sodium reabsorption
pteh05010  Alzheimer disease
pteh05020  Prion disease
pteh05022  Pathways of neurodegeneration - multiple diseases
pteh05034  Alcoholism
pteh05132  Salmonella infection
pteh05133  Pertussis
pteh05135  Yersinia infection
pteh05140  Leishmaniasis
pteh05142  Chagas disease
pteh05145  Toxoplasmosis
pteh05152  Tuberculosis
pteh05160  Hepatitis C
pteh05161  Hepatitis B
pteh05163  Human cytomegalovirus infection
pteh05164  Influenza A
pteh05165  Human papillomavirus infection
pteh05166  Human T-cell leukemia virus 1 infection
pteh05167  Kaposi sarcoma-associated herpesvirus infection
pteh05170  Human immunodeficiency virus 1 infection
pteh05171  Coronavirus disease - COVID-19
pteh05200  Pathways in cancer
pteh05203  Viral carcinogenesis
pteh05205  Proteoglycans in cancer
pteh05206  MicroRNAs in cancer
pteh05207  Chemical carcinogenesis - receptor activation
pteh05208  Chemical carcinogenesis - reactive oxygen species
pteh05210  Colorectal cancer
pteh05211  Renal cell carcinoma
pteh05212  Pancreatic cancer
pteh05213  Endometrial cancer
pteh05214  Glioma
pteh05215  Prostate cancer
pteh05216  Thyroid cancer
pteh05218  Melanoma
pteh05219  Bladder cancer
pteh05220  Chronic myeloid leukemia
pteh05221  Acute myeloid leukemia
pteh05223  Non-small cell lung cancer
pteh05224  Breast cancer
pteh05225  Hepatocellular carcinoma
pteh05226  Gastric cancer
pteh05230  Central carbon metabolism in cancer
pteh05231  Choline metabolism in cancer
pteh05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pteh05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pteh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111525729 (MAPK3)
   04012 ErbB signaling pathway
    111525729 (MAPK3)
   04014 Ras signaling pathway
    111525729 (MAPK3)
   04015 Rap1 signaling pathway
    111525729 (MAPK3)
   04350 TGF-beta signaling pathway
    111525729 (MAPK3)
   04370 VEGF signaling pathway
    111525729 (MAPK3)
   04371 Apelin signaling pathway
    111525729 (MAPK3)
   04668 TNF signaling pathway
    111525729 (MAPK3)
   04066 HIF-1 signaling pathway
    111525729 (MAPK3)
   04068 FoxO signaling pathway
    111525729 (MAPK3)
   04072 Phospholipase D signaling pathway
    111525729 (MAPK3)
   04071 Sphingolipid signaling pathway
    111525729 (MAPK3)
   04024 cAMP signaling pathway
    111525729 (MAPK3)
   04022 cGMP-PKG signaling pathway
    111525729 (MAPK3)
   04151 PI3K-Akt signaling pathway
    111525729 (MAPK3)
   04150 mTOR signaling pathway
    111525729 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    111525729 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111525729 (MAPK3)
   04148 Efferocytosis
    111525729 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    111525729 (MAPK3)
   04210 Apoptosis
    111525729 (MAPK3)
   04218 Cellular senescence
    111525729 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111525729 (MAPK3)
   04520 Adherens junction
    111525729 (MAPK3)
   04540 Gap junction
    111525729 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    111525729 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111525729 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    111525729 (MAPK3)
   04613 Neutrophil extracellular trap formation
    111525729 (MAPK3)
   04620 Toll-like receptor signaling pathway
    111525729 (MAPK3)
   04621 NOD-like receptor signaling pathway
    111525729 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    111525729 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    111525729 (MAPK3)
   04660 T cell receptor signaling pathway
    111525729 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    111525729 (MAPK3)
   04659 Th17 cell differentiation
    111525729 (MAPK3)
   04657 IL-17 signaling pathway
    111525729 (MAPK3)
   04662 B cell receptor signaling pathway
    111525729 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    111525729 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    111525729 (MAPK3)
   04062 Chemokine signaling pathway
    111525729 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    111525729 (MAPK3)
   04929 GnRH secretion
    111525729 (MAPK3)
   04912 GnRH signaling pathway
    111525729 (MAPK3)
   04915 Estrogen signaling pathway
    111525729 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    111525729 (MAPK3)
   04917 Prolactin signaling pathway
    111525729 (MAPK3)
   04921 Oxytocin signaling pathway
    111525729 (MAPK3)
   04926 Relaxin signaling pathway
    111525729 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    111525729 (MAPK3)
   04919 Thyroid hormone signaling pathway
    111525729 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    111525729 (MAPK3)
   04916 Melanogenesis
    111525729 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111525729 (MAPK3)
   04270 Vascular smooth muscle contraction
    111525729 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    111525729 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    111525729 (MAPK3)
   04725 Cholinergic synapse
    111525729 (MAPK3)
   04726 Serotonergic synapse
    111525729 (MAPK3)
   04720 Long-term potentiation
    111525729 (MAPK3)
   04730 Long-term depression
    111525729 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    111525729 (MAPK3)
   04722 Neurotrophin signaling pathway
    111525729 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    111525729 (MAPK3)
   04380 Osteoclast differentiation
    111525729 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    111525729 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111525729 (MAPK3)
   05206 MicroRNAs in cancer
    111525729 (MAPK3)
   05205 Proteoglycans in cancer
    111525729 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    111525729 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    111525729 (MAPK3)
   05203 Viral carcinogenesis
    111525729 (MAPK3)
   05230 Central carbon metabolism in cancer
    111525729 (MAPK3)
   05231 Choline metabolism in cancer
    111525729 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111525729 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111525729 (MAPK3)
   05212 Pancreatic cancer
    111525729 (MAPK3)
   05225 Hepatocellular carcinoma
    111525729 (MAPK3)
   05226 Gastric cancer
    111525729 (MAPK3)
   05214 Glioma
    111525729 (MAPK3)
   05216 Thyroid cancer
    111525729 (MAPK3)
   05221 Acute myeloid leukemia
    111525729 (MAPK3)
   05220 Chronic myeloid leukemia
    111525729 (MAPK3)
   05218 Melanoma
    111525729 (MAPK3)
   05211 Renal cell carcinoma
    111525729 (MAPK3)
   05219 Bladder cancer
    111525729 (MAPK3)
   05215 Prostate cancer
    111525729 (MAPK3)
   05213 Endometrial cancer
    111525729 (MAPK3)
   05224 Breast cancer
    111525729 (MAPK3)
   05223 Non-small cell lung cancer
    111525729 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111525729 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    111525729 (MAPK3)
   05161 Hepatitis B
    111525729 (MAPK3)
   05160 Hepatitis C
    111525729 (MAPK3)
   05171 Coronavirus disease - COVID-19
    111525729 (MAPK3)
   05164 Influenza A
    111525729 (MAPK3)
   05163 Human cytomegalovirus infection
    111525729 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111525729 (MAPK3)
   05165 Human papillomavirus infection
    111525729 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111525729 (MAPK3)
   05135 Yersinia infection
    111525729 (MAPK3)
   05133 Pertussis
    111525729 (MAPK3)
   05152 Tuberculosis
    111525729 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111525729 (MAPK3)
   05140 Leishmaniasis
    111525729 (MAPK3)
   05142 Chagas disease
    111525729 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111525729 (MAPK3)
   05020 Prion disease
    111525729 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    111525729 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    111525729 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111525729 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    111525729 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    111525729 (MAPK3)
   04934 Cushing syndrome
    111525729 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111525729 (MAPK3)
   01524 Platinum drug resistance
    111525729 (MAPK3)
   01522 Endocrine resistance
    111525729 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pteh01001]
    111525729 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pteh03036]
    111525729 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pteh04147]
    111525729 (MAPK3)
Enzymes [BR:pteh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111525729 (MAPK3)
Protein kinases [BR:pteh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111525729 (MAPK3)
Chromosome and associated proteins [BR:pteh03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     111525729 (MAPK3)
Exosome [BR:pteh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111525729 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 111525729
NCBI-ProteinID: XP_023047035
Ensembl: ENSPTEG00000023945
UniProt: A0A8C9HRL2
LinkDB
Position
17:27385313..27394484
AA seq 379 aa
MAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggtggggagccccggagagccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcaactgagcaat
gaccacatctgctacttcctctaccagatcctgcggggcctcaagtacatccactctgcc
aatgtgctccaccgggatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgcgatttcggcctggcacggattgccgatcctgagcatgaccacaccggcttc
ctgacggagtatgtggctacacgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcccggggcgctagaggccccctaa

DBGET integrated database retrieval system