KEGG   Piliocolobus tephrosceles (Ugandan red Colobus): 111526334
Entry
111526334         CDS       T07491                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
pteh  Piliocolobus tephrosceles (Ugandan red Colobus)
Pathway
pteh04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pteh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111526334 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pteh04050]
    111526334 (TNFRSF8)
   04090 CD molecules [BR:pteh04090]
    111526334 (TNFRSF8)
Cytokine receptors [BR:pteh04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111526334 (TNFRSF8)
CD molecules [BR:pteh04090]
 Proteins
  111526334 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 111526334
NCBI-ProteinID: XP_023047766
Ensembl: ENSPTEG00000031818
LinkDB
Position
1:complement(209688061..209770314)
AA seq 595 aa
MRALLAALGLLFLGALRAFPQDRPFEDTCRGNPSHYYDKAVRRCCYRCPTGLFPTQQCPQ
RPADCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKMPCAWNSSRVCECQPGMFCGVSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGLSPACASPENCKEPSSGTTPQAKPT
PVPPATSNASTMPLRGGARLAQEAASKLTRAPGSPSSVGRPSSDPGLSPTQPCPQGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRVCECRPGMVCATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCSPTPENGEAPASTSPTLSSLVDSQA
SKTLPIPTSAPIALSSTGKPVLDAGPVLFWVILVLAVVVGSSTFLLCHRRACRKRIRQKL
HLCYLVQTSRPKLELVDSRPRRSSTQLGSGAFVTEPSAEELGLMSRPLKETCHNEGAACP
ESLLLRDASPAGGPSSPRDLPEPRVSTEHTNNRIEKIYIMKADTVIVGTVKAELPEGQGL
AGPAEAELEEELEADHAPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcgcgccctcctcgccgcgctgggactgctgttcctgggggcgctccgagccttccca
caggatcggcccttcgaggacacctgtcgtggaaaccccagccactactatgacaaggct
gtcaggaggtgctgttaccgctgccccacggggctctttccgacacagcagtgcccacag
aggcctgctgactgcaggaagcagtgtgaacctgactactacctggatgaggccggccgc
tgtacagcctgcgtgagttgttctcgagacgacctcgtggagaagatgccgtgtgcatgg
aactcctcccgtgtctgcgaatgtcaacctggcatgttctgtggcgtgtctgctgtcaac
tcctgtgcccgctgcttcttccattctgtctgcccagcagggatgattgtcaagttccca
ggcacggcccagaagaacacggtctgtgaaccggcttccccagggctcagccctgcctgt
gccagcccggagaactgcaaggaaccctccagtggcaccaccccccaggccaagcccacc
ccggtgcccccagcaacctccaatgccagcaccatgcctctaagagggggcgcccgcctc
gcccaggaagctgcttctaaactgacgagggctcccggctctccctcctctgtgggaagg
cctagttcagatccaggtctgtccccaacgcagccgtgcccacaggggtctggcgactgc
aggaagcagtgtgagcctgactactacctggacgaggctggtcgctgcacggcctgcgtg
agctgttctcgagacgatctcgtggagaagacgccgtgtgcgtggaactcctcccgcgtc
tgcgaatgtcgacctggcatggtctgtgccacatcagccaccaactcctgtgcccgctgt
gtcccctacccaatctgtgcagcagagacagtcaccaagccccaggatatggctgagaag
gacaccacctttgaggcgccacccctggggacccagcctgactgcagccccaccccagag
aatggcgaggcgcctgccagcaccagccccactctgagctccctggtggactcccaggcc
agtaagacgctgcccatcccaaccagcgctcccatcgctctctcctccaccgggaagccc
gttctggatgcagggccagtgctcttctgggtgatcctggtgctggctgtggtggtcggc
tccagcaccttcctcctgtgccaccggagggcctgcaggaagcgaattcggcagaagctc
cacctgtgctacctggtccagacctcccggcccaagctagagcttgtggattccagaccc
aggaggagctcaacgcagctcgggagtggtgcgtttgtgacagaacccagtgcggaagag
ctggggttaatgagccggccactgaaggagacctgccacaatgaaggggcagcctgccca
gagagcctactgctgcgggatgccagcccggccgggggcccctcgtcccccagggacctt
cctgagccccgggtgtccacggagcacaccaataacaggattgagaaaatctacatcatg
aaggccgacactgtgatcgtgggaactgtgaaggcggagctgccagagggccagggcctg
gcggggccagcggaggccgagttggaggaggagctggaggcggaccatgccccccactac
cccgagcaggagacagagccgcctctgggcagctgcagtgacgtcatgctgtcagtggaa
gaggaagggaaagaagaccccttgcccacagctgcctctggaaagtga

DBGET integrated database retrieval system