KEGG   Piliocolobus tephrosceles (Ugandan red Colobus): 111538809
Entry
111538809         CDS       T07491                                 
Symbol
NDUFB8
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
  KO
K03964  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
pteh  Piliocolobus tephrosceles (Ugandan red Colobus)
Pathway
pteh00190  Oxidative phosphorylation
pteh01100  Metabolic pathways
pteh04714  Thermogenesis
pteh04723  Retrograde endocannabinoid signaling
pteh04932  Non-alcoholic fatty liver disease
pteh05010  Alzheimer disease
pteh05012  Parkinson disease
pteh05014  Amyotrophic lateral sclerosis
pteh05016  Huntington disease
pteh05020  Prion disease
pteh05022  Pathways of neurodegeneration - multiple diseases
pteh05208  Chemical carcinogenesis - reactive oxygen species
pteh05415  Diabetic cardiomyopathy
Module
pteh_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:pteh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111538809 (NDUFB8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    111538809 (NDUFB8)
  09159 Environmental adaptation
   04714 Thermogenesis
    111538809 (NDUFB8)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    111538809 (NDUFB8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111538809 (NDUFB8)
   05012 Parkinson disease
    111538809 (NDUFB8)
   05014 Amyotrophic lateral sclerosis
    111538809 (NDUFB8)
   05016 Huntington disease
    111538809 (NDUFB8)
   05020 Prion disease
    111538809 (NDUFB8)
   05022 Pathways of neurodegeneration - multiple diseases
    111538809 (NDUFB8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    111538809 (NDUFB8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111538809 (NDUFB8)
SSDB
Motif
Pfam: NDUF_B8
Other DBs
NCBI-GeneID: 111538809
NCBI-ProteinID: XP_023062199
Ensembl: ENSPTEG00000028011
UniProt: A0A8C9LTS2
LinkDB
Position
9:33191053..33197110
AA seq 186 aa
MAVARAGVLGVQWLQRASRNVVPLGARTASRMTKDMFPGPYPRTPEERAAAAKKYNMRVE
DYEPYPDEGMGYGDYPKLPDRSQHERDPWYSWDQPDLRLNWGEPMHWHVDMYTRNRVDTS
PTPVSWNVMCMQLFGFLAFMTFMFWVGDVYPVYQPVGPKQYPYNNLYLEQGGDPSKEPEP
VVHYEI
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcggtggccagggccggggtcctgggagttcagtggctgcaaagggcatcccggaac
gtggtgccgctgggcgcacggacagcctcccgcatgaccaaggatatgtttccggggccc
tatcctaggaccccagaagaacgggccgccgccgccaagaagtataatatgcgtgtggaa
gactacgagccttacccggatgagggcatggggtatggcgactacccgaagctccctgac
cgttcacagcatgagagggatccatggtatagctgggaccaaccggacctgaggttgaac
tggggtgaaccgatgcactggcacgtagacatgtacaccaggaaccgtgtggatacatcc
cccacacctgtttcttggaatgtcatgtgtatgcagctcttcggtttcctggctttcatg
acattcatgttctgggtgggggacgtgtaccctgtctaccagcctgtgggaccaaagcag
tatccttacaataatctgtacctggaacaaggcggcgatccctccaaagaacctgagccg
gtggttcactatgagatctga

DBGET integrated database retrieval system