KEGG   Piliocolobus tephrosceles (Ugandan red Colobus): 111540025
Entry
111540025         CDS       T07491                                 
Symbol
TP53AIP1
Name
(RefSeq) p53-regulated apoptosis-inducing protein 1 isoform X1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
pteh  Piliocolobus tephrosceles (Ugandan red Colobus)
Pathway
pteh04115  p53 signaling pathway
pteh04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:pteh00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111540025 (TP53AIP1)
   04115 p53 signaling pathway
    111540025 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 111540025
NCBI-ProteinID: XP_023063855
LinkDB
Position
13:complement(117991315..117993641)
AA seq 129 aa
MGSSSKASFRSAQASSSGARRQGLGRGDQSPSMMPPNGRAQTHTPGRGSPRSENRDGLLP
AVALRRLCSHCGADIPNFQTRQDPVTASVSPAQDTGRSWELTALINSPKRKASPLPPRNP
GFLEGRKVF
NT seq 390 nt   +upstreamnt  +downstreamnt
atggggtcttcctctaaggcgagcttcagatctgctcaagcttccagcagtggggccagg
aggcagggcctgggcaggggagaccagagcccctcgatgatgcctcccaatggcagggct
cagacacacacaccgggccggggaagcccccgcagtgaaaaccgagacggtcttttgcct
gccgtggccctgcgcagactctgctctcactgcggtgctgacatcccaaattttcagact
cgccaggacccagtgacagcctctgtgtccccagctcaggacactggacggagctgggaa
ctgacagccctgatcaatagtcccaagagaaaggccagtcctcttcctcctcggaatcct
gggtttctagaaggcagaaaggttttctga

DBGET integrated database retrieval system