KEGG   Piliocolobus tephrosceles (Ugandan red Colobus): 111549204
Entry
111549204         CDS       T07491                                 
Name
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
pteh  Piliocolobus tephrosceles (Ugandan red Colobus)
Pathway
pteh04014  Ras signaling pathway
pteh04015  Rap1 signaling pathway
pteh04020  Calcium signaling pathway
pteh04022  cGMP-PKG signaling pathway
pteh04024  cAMP signaling pathway
pteh04070  Phosphatidylinositol signaling system
pteh04114  Oocyte meiosis
pteh04218  Cellular senescence
pteh04261  Adrenergic signaling in cardiomyocytes
pteh04270  Vascular smooth muscle contraction
pteh04371  Apelin signaling pathway
pteh04625  C-type lectin receptor signaling pathway
pteh04713  Circadian entrainment
pteh04720  Long-term potentiation
pteh04722  Neurotrophin signaling pathway
pteh04728  Dopaminergic synapse
pteh04740  Olfactory transduction
pteh04744  Phototransduction
pteh04750  Inflammatory mediator regulation of TRP channels
pteh04910  Insulin signaling pathway
pteh04912  GnRH signaling pathway
pteh04915  Estrogen signaling pathway
pteh04916  Melanogenesis
pteh04921  Oxytocin signaling pathway
pteh04922  Glucagon signaling pathway
pteh04924  Renin secretion
pteh04925  Aldosterone synthesis and secretion
pteh04970  Salivary secretion
pteh04971  Gastric acid secretion
pteh05010  Alzheimer disease
pteh05012  Parkinson disease
pteh05022  Pathways of neurodegeneration - multiple diseases
pteh05031  Amphetamine addiction
pteh05034  Alcoholism
pteh05133  Pertussis
pteh05152  Tuberculosis
pteh05163  Human cytomegalovirus infection
pteh05167  Kaposi sarcoma-associated herpesvirus infection
pteh05170  Human immunodeficiency virus 1 infection
pteh05200  Pathways in cancer
pteh05214  Glioma
pteh05417  Lipid and atherosclerosis
pteh05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pteh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111549204
   04015 Rap1 signaling pathway
    111549204
   04371 Apelin signaling pathway
    111549204
   04020 Calcium signaling pathway
    111549204
   04070 Phosphatidylinositol signaling system
    111549204
   04024 cAMP signaling pathway
    111549204
   04022 cGMP-PKG signaling pathway
    111549204
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111549204
   04218 Cellular senescence
    111549204
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111549204
  09152 Endocrine system
   04910 Insulin signaling pathway
    111549204
   04922 Glucagon signaling pathway
    111549204
   04912 GnRH signaling pathway
    111549204
   04915 Estrogen signaling pathway
    111549204
   04921 Oxytocin signaling pathway
    111549204
   04916 Melanogenesis
    111549204
   04924 Renin secretion
    111549204
   04925 Aldosterone synthesis and secretion
    111549204
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111549204
   04270 Vascular smooth muscle contraction
    111549204
  09154 Digestive system
   04970 Salivary secretion
    111549204
   04971 Gastric acid secretion
    111549204
  09156 Nervous system
   04728 Dopaminergic synapse
    111549204
   04720 Long-term potentiation
    111549204
   04722 Neurotrophin signaling pathway
    111549204
  09157 Sensory system
   04744 Phototransduction
    111549204
   04740 Olfactory transduction
    111549204
   04750 Inflammatory mediator regulation of TRP channels
    111549204
  09159 Environmental adaptation
   04713 Circadian entrainment
    111549204
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111549204
  09162 Cancer: specific types
   05214 Glioma
    111549204
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111549204
   05163 Human cytomegalovirus infection
    111549204
   05167 Kaposi sarcoma-associated herpesvirus infection
    111549204
  09171 Infectious disease: bacterial
   05133 Pertussis
    111549204
   05152 Tuberculosis
    111549204
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111549204
   05012 Parkinson disease
    111549204
   05022 Pathways of neurodegeneration - multiple diseases
    111549204
  09165 Substance dependence
   05031 Amphetamine addiction
    111549204
   05034 Alcoholism
    111549204
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    111549204
   05418 Fluid shear stress and atherosclerosis
    111549204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pteh01009]
    111549204
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pteh04131]
    111549204
   03036 Chromosome and associated proteins [BR:pteh03036]
    111549204
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pteh04147]
    111549204
Protein phosphatases and associated proteins [BR:pteh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     111549204
Membrane trafficking [BR:pteh04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    111549204
Chromosome and associated proteins [BR:pteh03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     111549204
Exosome [BR:pteh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111549204
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen UPF0154 Dockerin_1 DUF1103 Caleosin FCaBP_EF-hand Poly_export SPEF2_C TerB DUF5580_M PhageMin_Tail MotA_activ PA_Ig-like Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 111549204
NCBI-ProteinID: XP_023078098
LinkDB
Position
7:67857067..67858197
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLIDE
EVDEMIREADIDGDGQVNYEEFVQMMTAR
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgaccaactgaccgaagagcagattgcagaattcaaagaagctttttcactattt
gacaaagatggtgatggaactataacaacaaaggaattgggaactgtaatgaggtctctt
gggcagaatcccacagaagcagagttacaggacatgattaatgaagtagatgctgatggt
aatggcacaattgacttccctgaatttctgacaatgatggcaagaaaaatgaaagacaca
gacagtgaagaagaaattagagaagcattccgtgtgtttgataaggatggcaatggctat
attagtgctgcagaacttcgccatgtgatgacaaaccttggagagaagttaatagatgaa
gaagttgatgaaatgatcagggaagcagatattgatggtgatggtcaagtaaactatgaa
gagtttgtacaaatgatgacagcaaggtga

DBGET integrated database retrieval system