Paraburkholderia terrae: C2L65_03680 Help Entry C2L65_03680       CDS       T05318                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pter  Paraburkholderia terrae Pathway pter00998   Biosynthesis of various antibiotics pter01100   Metabolic pathways pter01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pter00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2L65_03680    00074 Mycolic acid biosynthesis     C2L65_03680   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2L65_03680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Raf1_N TerB Motif Other DBs NCBI-ProteinID:  AUT58797 UniProt:  A0A2I8EGT5 LinkDB All DBs Position 1:813998..814255 Genome browser AA seq 85 aa AA seqDB search MTVTDTEILERIRAIFKENFAIEPERVTPEAHLFEELDLDSIDAVDLAIKLQEMTGRRIK PEEFKSVRTVGDVIAAVESLLAAQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgtgaccgacaccgagatccttgagcgcatccgcgccatcttcaaagagaacttc gccatcgagcccgaacgcgtgacgcccgaagcgcacctgttcgaagagctcgatctggac agcatcgacgccgtcgatctcgcgatcaagttgcaggagatgacgggccgccggatcaag cccgaggagttcaagtcggtgcgcacggttggcgacgtgatcgcggcggtcgagtcgctg ctcgcggcgcagggctga

DBGET integrated database retrieval system