Paraburkholderia terrae: C2L65_04420 Help Entry C2L65_04420       CDS       T05318                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pter  Paraburkholderia terrae Pathway pter00998   Biosynthesis of various antibiotics pter01100   Metabolic pathways pter01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pter00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2L65_04420    00074 Mycolic acid biosynthesis     C2L65_04420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2L65_04420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AUT58928 UniProt:  A0A2I8EHP4 LinkDB All DBs Position 1:974862..975101 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaatatcgaacagcgcgtcaagaagatcgttgcagaacaactcggtgttgccgaa gcggaaatcaagaacgaagcatcgttcgtgaacgacctcggcgctgactcgctcgacacg gtcgagctggtgatggctctcgaagacgaattcggcatggaaattccggatgaagaagcc gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcctaa

DBGET integrated database retrieval system