Paraburkholderia terrae: C2L65_07815 Help Entry C2L65_07815       CDS       T05318                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism pter  Paraburkholderia terrae Pathway pter00361   Chlorocyclohexane and chlorobenzene degradation pter00362   Benzoate degradation pter00623   Toluene degradation pter01100   Metabolic pathways pter01120   Microbial metabolism in diverse environments pter01220   Degradation of aromatic compounds Module pter_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:pter00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     C2L65_07815    00361 Chlorocyclohexane and chlorobenzene degradation     C2L65_07815    00623 Toluene degradation     C2L65_07815 Enzymes [BR:pter01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      C2L65_07815     1.14.13.244  phenol 2-monooxygenase (NADH)      C2L65_07815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  AUT59514 UniProt:  A0A2I8EKZ5 LinkDB All DBs Position 1:1740575..1740847 Genome browser AA seq 90 aa AA seqDB search MADSVFIAFQANDDSRPIIEAIQADNPHAVVNAFPAMVKIDAVGKLVIRRESIEALIGRE FDLRELQLNLISLGGNIDETDDEFILEWKA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggctgattccgttttcatcgcgtttcaggccaacgacgattcacggccgatcatcgag gctattcaagccgacaacccgcatgccgtcgtcaacgcgtttcccgcgatggtcaagatc gatgccgtcggcaaactcgtgatccggcgcgaatcgatcgaagcactgatcggacgtgag ttcgatttgcgcgaactgcaactgaacctgatttcactcggcggcaacatcgacgagacg gacgacgaattcatcctcgaatggaaagcctga

DBGET integrated database retrieval system