Paraburkholderia terrae: C2L65_15765 Help Entry C2L65_15765       CDS       T05318                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pter  Paraburkholderia terrae Pathway pter00190   Oxidative phosphorylation pter01100   Metabolic pathways Module pter_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pter00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C2L65_15765  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pter00194]     C2L65_15765 Photosynthesis proteins [BR:pter00194]  Photosystem and electron transport system   F-type ATPase [OT]    C2L65_15765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AUT60920 UniProt:  A0A2I8EN49 LinkDB All DBs Position 1:complement(3544375..3544644) Genome browser AA seq 89 aa AA seqDB search MQAFIANIQGLTAIGIGIIIGLGAIGACIGIGLMGGKYIEACARQPELMNPLQTKMFLLA GLIDAAFLIGVGVAMLFAFANPLLSKLAG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcaagctttcatcgccaacatccagggtctgaccgccatcggtatcggcatcatcatc ggcctgggtgctatcggcgcctgtatcggtatcggtctgatgggcggcaagtacatcgaa gcatgcgctcgccagccggaactgatgaacccgctgcaaaccaagatgttcctgctggct ggtctgatcgatgcggcgttcctgattggcgttggtgtggcaatgctgtttgcgtttgcg aacccgctgctgtcgaagctggcaggctga

DBGET integrated database retrieval system