Paraburkholderia terrae: C2L65_37920 Help Entry C2L65_37920       CDS       T05318                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism pter  Paraburkholderia terrae Brite KEGG Orthology (KO) [BR:pter00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pter03036]     C2L65_37920    03400 DNA repair and recombination proteins [BR:pter03400]     C2L65_37920 Chromosome and associated proteins [BR:pter03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     C2L65_37920 DNA repair and recombination proteins [BR:pter03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       C2L65_37920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS REST_helical Motif Other DBs NCBI-ProteinID:  AUT66181 UniProt:  A0A2I8F3R2 LinkDB All DBs Position 3:1831129..1831404 Genome browser AA seq 91 aa AA seqDB search MQTRKHNVSAVIEHLEGEARERLIVWLKRRMQECNITLEALQHALQQDIDEAKRIRYRDA WGNTWTGDGEHPEWLRRAVAAGQSIDHFLCE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt ttgcaaacgaggaaacacaacgtgtccgccgtcattgaacatctcgaaggcgaagcgcgc gagcgcctgattgtctggctcaaacgccgcatgcaggagtgcaatatcacgttggaagcg ctgcaacatgcgctgcagcaggatatcgacgaagcgaaacggatccgctaccgcgatgcg tggggcaatacgtggacgggcgacggcgagcacccggaatggctgcgccgcgcggtggcg gcggggcaaagcatcgatcactttctgtgcgagtga

DBGET integrated database retrieval system