Paraburkholderia terrae: C2L65_38005 Help Entry C2L65_38005       CDS       T05318                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pter  Paraburkholderia terrae Pathway pter00362   Benzoate degradation pter00621   Dioxin degradation pter00622   Xylene degradation pter01100   Metabolic pathways pter01120   Microbial metabolism in diverse environments pter01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:pter00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     C2L65_38005    00622 Xylene degradation     C2L65_38005    00621 Dioxin degradation     C2L65_38005 Enzymes [BR:pter01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      C2L65_38005 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  AUT65340 UniProt:  A0A2I8F0T5 LinkDB All DBs Position 3:1844533..1844769 Genome browser AA seq 78 aa AA seqDB search MPIVTIQVTREGTKPGADCVTAEEKARLIKGVSQVLLDVLNKPLESTFVVIEEVPTDNWG WGGLPALEYRKLKAAKSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgccgattgtcacaattcaggttacgcgagaagggacgaaacccggcgcggattgcgtg acggccgaagaaaaggcgcgactcatcaagggcgtgagccaggtgttgcttgacgtgctg aacaagccgctcgagtccaccttcgttgtgatcgaggaagtgccgacggacaattggggc tggggcggtctgcctgccctcgagtatcgaaagctcaaagcagcgaaatcagcctga

DBGET integrated database retrieval system