Paraburkholderia terrae: C2L65_42125 Help Entry C2L65_42125       CDS       T05318                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pter  Paraburkholderia terrae Brite KEGG Orthology (KO) [BR:pter00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pter03032]     C2L65_42125    03036 Chromosome and associated proteins [BR:pter03036]     C2L65_42125    03400 DNA repair and recombination proteins [BR:pter03400]     C2L65_42125 DNA replication proteins [BR:pter03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C2L65_42125 Chromosome and associated proteins [BR:pter03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C2L65_42125 DNA repair and recombination proteins [BR:pter03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C2L65_42125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AUT66326 UniProt:  A0A2I8F376 LinkDB All DBs Position 4:complement(90777..91052) Genome browser AA seq 91 aa AA seqDB search MNKQELIDAVSAVTGDSKSATVQVIDAFTEIVGAALAKGDTVQLIGFGSFGVGGRAARTG RNPATGEAMQIAAAKTIKFTAGKAFKERVNA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaggaactcatcgatgcagtatcggccgtcaccggcgacagcaaatcggcc acggtacaagtcatcgacgccttcaccgaaatcgttggcgccgcgttggcgaagggggac accgtgcagttgatcggcttcggctcgttcggcgtcggtggacgcgctgcacgcacggga cgcaatcccgccacgggcgaggcaatgcagattgctgccgcaaaaaccatcaagttcacg gcaggtaaggccttcaaggagcgcgtgaacgcgtaa

DBGET integrated database retrieval system