Paralysiella testudinis: JQU52_00460 Help Entry JQU52_00460       CDS       T07686                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptes  Paralysiella testudinis Pathway ptes01100   Metabolic pathways ptes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JQU52_00460 (acpP)    00074 Mycolic acid biosynthesis     JQU52_00460 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JQU52_00460 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QRQ81953 UniProt:  A0A892ZH36 LinkDB All DBs Position complement(94209..94448) Genome browser AA seq 79 aa AA seqDB search MENNIEQRVKKIVAEQLGVSEAEVKNESSFQEDLGADSLDTVELVMALEEAFGCEIPDEE AEKITTVQQAIDFVSAHLN NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaaacaacatcgaacaacgcgtgaagaaaattgttgcagaacaattgggcgtgagc gaagccgaagtgaaaaacgaatcttctttccaagaagatttgggcgccgactcgctggac accgttgagctggttatggctttggaagaagccttcggttgcgaaattccggatgaagaa gccgagaaaatcaccaccgtacagcaagccattgattttgttagcgcacatctgaactaa

DBGET integrated database retrieval system