Paralysiella testudinis: JQU52_00665 Help Entry JQU52_00665       CDS       T07686                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptes  Paralysiella testudinis Pathway ptes01100   Metabolic pathways ptes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JQU52_00665    00074 Mycolic acid biosynthesis     JQU52_00665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JQU52_00665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QRQ81994 UniProt:  A0A892ZKA8 LinkDB All DBs Position complement(139374..139631) Genome browser AA seq 85 aa AA seqDB search MLTRDNINTMLGDALVELFEIEPQRITPTANLYEDLEIDSIDAIDLIDHIKRQTGHKLLA DDFRSVRTVDDVVEAVWQKICSANP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgttaacccgcgataacatcaacaccatgcttggcgatgcgttggtggaattatttgaa atcgagccgcagcgcatcacgcccacggccaatctgtatgaagatttggaaatcgacagc atcgacgccatcgatttaatcgaccacatcaaacgccaaaccggccataaactgctggcc gatgattttcgcagtgtgcgcacggtggatgatgtggtggaagcggtatggcagaaaatc tgcagcgccaatccataa

DBGET integrated database retrieval system