Puntigrus tetrazona (Sumatra barb): 122326174 Help Entry 122326174         CDS       T08985                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism ptet  Puntigrus tetrazona (Sumatra barb) Pathway ptet04814   Motor proteins ptet05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptet00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     122326174 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122326174 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptet03037]     122326174 (dynll2b)    04812 Cytoskeleton proteins [BR:ptet04812]     122326174 (dynll2b) Cilium and associated proteins [BR:ptet03037]  Motile cilia and associated proteins   Dynein arm    122326174 (dynll2b) Cytoskeleton proteins [BR:ptet04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      122326174 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  122326174 NCBI-ProteinID:  XP_043076826 LinkDB All DBs Position 21:complement(14218607..14222690) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccgacaggaaggcagtaataaagaacgctgatatgtctgaggacatgcagcaggat gcagtggattgtgccacacaggccatggagaagtacaacatcgagaaggacattgctgcg tatatcaaaaaggagttcgataagaagtataatccgacatggcattgtatcgtgggacgg aactttggcagttatgtgacgcatgagactaagcacttcatctacttttacttgggtcaa gtggccattctgctcttcaaatcaggctga

DBGET integrated database retrieval system