Puntigrus tetrazona (Sumatra barb): 122327146 Help Entry 122327146         CDS       T08985                                  Symbol dnal4b Name (RefSeq) dynein, axonemal, light chain 4b   KO K10412   dynein axonemal light chain 4 Organism ptet  Puntigrus tetrazona (Sumatra barb) Pathway ptet04814   Motor proteins Brite KEGG Orthology (KO) [BR:ptet00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     122327146 (dnal4b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptet03037]     122327146 (dnal4b)    04812 Cytoskeleton proteins [BR:ptet04812]     122327146 (dnal4b) Cilium and associated proteins [BR:ptet03037]  Motile cilia and associated proteins   Dynein arm    122327146 (dnal4b) Cytoskeleton proteins [BR:ptet04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      122327146 (dnal4b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  122327146 NCBI-ProteinID:  XP_043078266 LinkDB All DBs Position 22:complement(12349018..12350814) Genome browser AA seq 106 aa AA seqDB search MAETVDGKKDEADYKRLHSFPLIRHTDMSEEMRVETMELCVTACEKFATNNESAAKMIKE SMDKKFGSSWHVVIGEGFGFEITHEVKNLLYMFFGGGLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagagacggtcgatggcaagaaggacgaggcagactacaagagactacacagcttt cctctcatacggcacacagatatgtctgaggagatgcgagtggagaccatggagctctgc gttacggcgtgcgagaagttcgccactaataacgagagcgccgccaaaatgataaaggag tccatggataagaagtttgggagctcttggcacgtggtgattggagagggcttcggtttc gaaatcacgcacgaagtgaagaacctgctttacatgttcttcggcggaggtttggcggtg tgcgtatggaagtgttcctaa

DBGET integrated database retrieval system