Puntigrus tetrazona (Sumatra barb): 122331115 Help Entry 122331115         CDS       T08985                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism ptet  Puntigrus tetrazona (Sumatra barb) Pathway ptet04010   MAPK signaling pathway ptet04012   ErbB signaling pathway ptet04068   FoxO signaling pathway ptet04137   Mitophagy - animal ptet04140   Autophagy - animal ptet04144   Endocytosis ptet04150   mTOR signaling pathway ptet04210   Apoptosis ptet04218   Cellular senescence ptet04370   VEGF signaling pathway ptet04371   Apelin signaling pathway ptet04510   Focal adhesion ptet04540   Gap junction ptet04625   C-type lectin receptor signaling pathway ptet04810   Regulation of actin cytoskeleton ptet04910   Insulin signaling pathway ptet04912   GnRH signaling pathway ptet04916   Melanogenesis ptet05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptet00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122331115 (hrasa)    04012 ErbB signaling pathway     122331115 (hrasa)    04370 VEGF signaling pathway     122331115 (hrasa)    04371 Apelin signaling pathway     122331115 (hrasa)    04068 FoxO signaling pathway     122331115 (hrasa)    04150 mTOR signaling pathway     122331115 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122331115 (hrasa)    04140 Autophagy - animal     122331115 (hrasa)    04137 Mitophagy - animal     122331115 (hrasa)   09143 Cell growth and death    04210 Apoptosis     122331115 (hrasa)    04218 Cellular senescence     122331115 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122331115 (hrasa)    04540 Gap junction     122331115 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122331115 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122331115 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     122331115 (hrasa)    04912 GnRH signaling pathway     122331115 (hrasa)    04916 Melanogenesis     122331115 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122331115 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptet04131]     122331115 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptet04147]     122331115 (hrasa)    04031 GTP-binding proteins [BR:ptet04031]     122331115 (hrasa) Membrane trafficking [BR:ptet04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     122331115 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     122331115 (hrasa) Exosome [BR:ptet04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    122331115 (hrasa)   Exosomal proteins of colorectal cancer cells    122331115 (hrasa) GTP-binding proteins [BR:ptet04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122331115 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  122331115 NCBI-ProteinID:  XP_043084510 LinkDB All DBs Position 25:14273349..14286360 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggacgaatacgaccccactatagaggactcctac aggaagcaggtggtgatcgacggagagacgtgtctcctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggagcagatc aagcgcgtgaaggactcggacgacgtgcccatggtgttggtgggtaataagtgcgacctc ccggcccggacggtggacacccggcaggcgcaggaactcgctcgcagctacggcatcccc ttcatcgagacctcggccaaaacacgacagggtgtggaggacgcgttttacacgctggtg cgagagatccgtcagcacaagatgaggaagctgaacccgccggacgagagcggtcaggac tgcatgagctgccgctgcgtcgtgtcgtga

DBGET integrated database retrieval system