Puntigrus tetrazona (Sumatra barb): 122346894 Help Entry 122346894         CDS       T08985                                  Symbol rhoca Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism ptet  Puntigrus tetrazona (Sumatra barb) Pathway ptet04081   Hormone signaling ptet04144   Endocytosis ptet04150   mTOR signaling pathway ptet04270   Vascular smooth muscle contraction ptet04310   Wnt signaling pathway ptet04350   TGF-beta signaling pathway ptet04510   Focal adhesion ptet04520   Adherens junction ptet04530   Tight junction ptet04621   NOD-like receptor signaling pathway ptet04625   C-type lectin receptor signaling pathway ptet04810   Regulation of actin cytoskeleton ptet05100   Bacterial invasion of epithelial cells ptet05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptet00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     122346894 (rhoca)    04350 TGF-beta signaling pathway     122346894 (rhoca)    04150 mTOR signaling pathway     122346894 (rhoca)   09133 Signaling molecules and interaction    04081 Hormone signaling     122346894 (rhoca)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122346894 (rhoca)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122346894 (rhoca)    04520 Adherens junction     122346894 (rhoca)    04530 Tight junction     122346894 (rhoca)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122346894 (rhoca)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     122346894 (rhoca)    04625 C-type lectin receptor signaling pathway     122346894 (rhoca)   09153 Circulatory system    04270 Vascular smooth muscle contraction     122346894 (rhoca)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122346894 (rhoca)    05100 Bacterial invasion of epithelial cells     122346894 (rhoca)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptet04131]     122346894 (rhoca)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptet04147]     122346894 (rhoca)    04031 GTP-binding proteins [BR:ptet04031]     122346894 (rhoca) Membrane trafficking [BR:ptet04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     122346894 (rhoca) Exosome [BR:ptet04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122346894 (rhoca)   Exosomal proteins of other body fluids (saliva and urine)    122346894 (rhoca)   Exosomal proteins of colorectal cancer cells    122346894 (rhoca)   Exosomal proteins of bladder cancer cells    122346894 (rhoca) GTP-binding proteins [BR:ptet04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     122346894 (rhoca) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  122346894 NCBI-ProteinID:  XP_043097703 LinkDB All DBs Position 6:complement(24178416..24191781) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELTKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQ VRKRKKRSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcggctatcaggaaaaagctggtgatcgtgggagacggagcgtgtgggaagacctgt ctcctcatagtgttcagcaaagaccagtttccagaagtctatgtgcctactgtgttcgag aactacatcgcagacatcgaagtcgacagcaaacaggtggagttggcattgtgggacaca gcaggacaggaagactacgatcgtctgaggcctctgtcctacccagacacagatgtcatc ctcatgtgtttctccatagacagtcctgacagtttagaaaacatcccagaaaagtggacg ccggaggtgaagcacttctgccccaacgttcccataatcctcgtgggcaataagaaggat ctgcgcaacgatgagcacacacggagagagctgactaagatgaagcaggagccagttaaa ccggaggagggcagggatatggccaaccgcattagcgccttcggctacctggaatgctca gctaagactaaggagggcgtgagggaggtgttcgaaatggccaccagggcggcgctgcaa gtccgcaagaggaagaagaggagcgggtgcttgctgttgtga

DBGET integrated database retrieval system