Puntigrus tetrazona (Sumatra barb): 122350810 Help Entry 122350810         CDS       T08985                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ptet  Puntigrus tetrazona (Sumatra barb) Pathway ptet04010   MAPK signaling pathway ptet04012   ErbB signaling pathway ptet04068   FoxO signaling pathway ptet04137   Mitophagy - animal ptet04140   Autophagy - animal ptet04150   mTOR signaling pathway ptet04210   Apoptosis ptet04218   Cellular senescence ptet04370   VEGF signaling pathway ptet04371   Apelin signaling pathway ptet04540   Gap junction ptet04625   C-type lectin receptor signaling pathway ptet04810   Regulation of actin cytoskeleton ptet04910   Insulin signaling pathway ptet04912   GnRH signaling pathway ptet04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ptet00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122350810 (nras)    04012 ErbB signaling pathway     122350810 (nras)    04370 VEGF signaling pathway     122350810 (nras)    04371 Apelin signaling pathway     122350810 (nras)    04068 FoxO signaling pathway     122350810 (nras)    04150 mTOR signaling pathway     122350810 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122350810 (nras)    04137 Mitophagy - animal     122350810 (nras)   09143 Cell growth and death    04210 Apoptosis     122350810 (nras)    04218 Cellular senescence     122350810 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     122350810 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122350810 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122350810 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     122350810 (nras)    04912 GnRH signaling pathway     122350810 (nras)    04916 Melanogenesis     122350810 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptet04131]     122350810 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptet04147]     122350810 (nras)    04031 GTP-binding proteins [BR:ptet04031]     122350810 (nras) Membrane trafficking [BR:ptet04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     122350810 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     122350810 (nras) Exosome [BR:ptet04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122350810 (nras)   Exosomal proteins of other body fluids (saliva and urine)    122350810 (nras)   Exosomal proteins of breast cancer cells    122350810 (nras)   Exosomal proteins of colorectal cancer cells    122350810 (nras) GTP-binding proteins [BR:ptet04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122350810 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  122350810 NCBI-ProteinID:  XP_043103476 LinkDB All DBs Position 8:complement(5423591..5431733) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNLKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttggttgttgtgggagcaggtggtgttgggaagagtgctttaacc atccagctcattcagaatcactttgtggatgaatatgaccctaccattgaggattcttac aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggt caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt gtctttgccataaacaacctcaaatccttcgccgatgtgcatttgtacagagaacagatc aagcgcgtgaaggactctgacgatgtccccatggtcctagtggggaacaagtgtgatttg gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcattgagttt gtagaaacctctgccaagaccagacagggagttgaggatgctttttacaccctcgtccgt gagatccggcattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system