Panthera tigris altaica (Amur tiger): 102949998 Help Entry 102949998         CDS       T02988                                  Symbol CLDN1 Name (RefSeq) claudin 1   KO K06087   claudin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03272   Virion - Hepatitis viruses ptg04382   Cornified envelope formation ptg04514   Cell adhesion molecules ptg04530   Tight junction ptg04670   Leukocyte transendothelial migration ptg05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102949998 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102949998 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102949998 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102949998 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     102949998 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102949998 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptg03037]     102949998 (CLDN1)    04147 Exosome [BR:ptg04147]     102949998 (CLDN1)    04515 Cell adhesion molecules [BR:ptg04515]     102949998 (CLDN1) Cilium and associated proteins [BR:ptg03037]  Other cilia and associated proteins   Stereociliary proteins    102949998 (CLDN1) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102949998 (CLDN1)   Exosomal proteins of colorectal cancer cells    102949998 (CLDN1) Cell adhesion molecules [BR:ptg04515]  Immunoglobulin superfamily   L1 family    102949998 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 SUR7 Voltage_CLC Cytochrom_B_C TMEM174 HAAS_TM DUF2207_C DUF6594 Motif Other DBs NCBI-GeneID:  102949998 NCBI-ProteinID:  XP_007083612 UniProt:  A0A8C9M920 LinkDB All DBs Position Un AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEVQKMRMAV IGGVTFLIAGLAVLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcagctgttaggcttcatcctggccttcctgggctggatcggc tccatcgtcagcacggcactgccccaatggaagatttactcctacgccggcgacaacatc gtgactgcccaggccatctacgaggggctgtggatgtcctgcgtgtcacagagcaccggg cagatacagtgcaaagtcttcgactccttgctgaatctgaacagcactttgcaagcaacc cgcgctttgatggtgattggcatccttctgggacttatagccatctttgtggccactgtt ggcatgaagtgtatgaagtgcatggaggacgatgaggtgcagaagatgcggatggctgtc attgggggtgtgacatttctcattgcaggtctggctgttttagttgccacagcatggtat ggcaatagaattgttcaagaattttatgatcccatgaccccggtcaatgccaggtatgaa ttcggtcaggctctcttcactggctgggctgctgcttctctctgccttctgggaggtgcc ctactttgctgttcctgtccccggaaaacaacatcttacccaacgccacggccttatcca aaacctgcaccttccagtgggaaagactacgtgtga

DBGET integrated database retrieval system