Panthera tigris altaica (Amur tiger): 102950367 Help Entry 102950367         CDS       T02988                                  Symbol UBB Name (RefSeq) ubiquitin B   KO K04551   ubiquitin B Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04120   Ubiquitin mediated proteolysis ptg04137   Mitophagy - animal ptg04140   Autophagy - animal ptg05012   Parkinson disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05167   Kaposi sarcoma-associated herpesvirus infection Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102950367 (UBB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102950367 (UBB)    04137 Mitophagy - animal     102950367 (UBB)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102950367 (UBB)   09164 Neurodegenerative disease    05012 Parkinson disease     102950367 (UBB)    05022 Pathways of neurodegeneration - multiple diseases     102950367 (UBB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ptg04121]     102950367 (UBB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102950367 (UBB) Ubiquitin system [BR:ptg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    102950367 (UBB) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of breast milk    102950367 (UBB)   Exosomal proteins of other body fluids (saliva and urine)    102950367 (UBB)   Exosomal proteins of colorectal cancer cells    102950367 (UBB)   Exosomal proteins of bladder cancer cells    102950367 (UBB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N HATPase_c UBL_UBAC1 Motif Other DBs NCBI-GeneID:  102950367 NCBI-ProteinID:  XP_007080814 UniProt:  A0A8C9J6D3 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcaaatcttcgtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagt gacaccatcgaaaacgtgaaggccaagatccaggataaggagggcatccccccagaccag cagaggctcatctttgcaggcaagcagctggaggatggccgcactctttctgattacaac atccagaaagagtcgaccctgcacctggtcctgcgtctgaggggtggtatgcagatcttc gtgaagaccctgaccggcaagaccatcaccctggaggtggagcccagtgacaccatcgaa aacgtgaaggccaagatccaggataaagaaggcatcccccctgaccagcagaggctcatc tttgcaggcaagcagctggaggatggccgcactctttctgattacaacatccagaaagag tccactctccatctggttcttcgtctgaggggtggctgttaa

DBGET integrated database retrieval system