Panthera tigris altaica (Amur tiger): 102950523 Help Entry 102950523         CDS       T02988                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04613   Neutrophil extracellular trap formation ptg05034   Alcoholism ptg05202   Transcriptional misregulation in cancer ptg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102950523  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102950523   09163 Immune disease    05322 Systemic lupus erythematosus     102950523   09165 Substance dependence    05034 Alcoholism     102950523  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102950523   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102950523 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102950523 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102950523 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF Zf-C2H2_ZNF451 Motif Other DBs NCBI-GeneID:  102950523 NCBI-ProteinID:  XP_007074508 LinkDB All DBs Position Un AA seq 75 aa AA seqDB search FQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIHL PCRIHGGAGLSSFSQ NT seq 228 nt NT seq  +upstreamnt  +downstreamnt ttccagcggctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgcttccagagc tcggccgtgatggcgctgcaggaggcgtgcgaggcctacctggtggggctcttcgaggac accaacctgtgcgccatccacgccaagcgcgtcaccatcatgcccaaggacatccacctg ccgtgccgcatccatgggggagcgggcctaagttccttcagccagtga

DBGET integrated database retrieval system