Panthera tigris altaica (Amur tiger): 102951286 Help Entry 102951286         CDS       T02988                                  Symbol DYNLL2 Name (RefSeq) dynein light chain LC8-type 2   KO K10418   dynein light chain LC8-type Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04145   Phagocytosis ptg04517   IgSF CAM signaling ptg04814   Motor proteins ptg04962   Vasopressin-regulated water reabsorption ptg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102951286 (DYNLL2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     102951286 (DYNLL2)   09142 Cell motility    04814 Motor proteins     102951286 (DYNLL2)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102951286 (DYNLL2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102951286 (DYNLL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptg03037]     102951286 (DYNLL2)    04812 Cytoskeleton proteins [BR:ptg04812]     102951286 (DYNLL2) Cilium and associated proteins [BR:ptg03037]  Motile cilia and associated proteins   Dynein arm    102951286 (DYNLL2) Cytoskeleton proteins [BR:ptg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102951286 (DYNLL2) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Motif Other DBs NCBI-GeneID:  102951286 NCBI-ProteinID:  XP_007086772 LinkDB All DBs Position Un AA seq 104 aa AA seqDB search MGLSASPLCFFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKE FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggggctgtcagcttcacctctctgcttcttctgcagtgtcacgatgtctgaccggaag gcagtgatcaagaatgcagacatgtctgaggacatgcaacaggatgccgttgactgcgcc acgcaggctatggagaagtacaacatagagaaggacattgctgcctatatcaagaaggaa tttgacaagaaatataaccctacctggcattgtatcgtgggccgaaattttggcagctat gttacacacgagacaaagcacttcatctatttttacttgggtcaagttgcaatcctcctc ttcaagtcaggctag

DBGET integrated database retrieval system