Panthera tigris altaica (Amur tiger): 102952857 Help Entry 102952857         CDS       T02988                                  Symbol DUSP15 Name (RefSeq) dual specificity phosphatase 15   KO K14165   atypical dual specificity phosphatase [EC:3.1.3.16 3.1.3.48] Organism ptg  Panthera tigris altaica (Amur tiger) Brite KEGG Orthology (KO) [BR:ptg00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptg01009]     102952857 (DUSP15) Enzymes [BR:ptg01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.3  Phosphoric-monoester hydrolases     3.1.3.16  protein-serine/threonine phosphatase      102952857 (DUSP15)     3.1.3.48  protein-tyrosine-phosphatase      102952857 (DUSP15) Protein phosphatases and associated proteins [BR:ptg01009]  Protein tyrosine phosphatases (PTPs)   Class I PTPs (Dual specificity phosphatases)    Atypical DSPs     102952857 (DUSP15) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSPc HMMR_C Motif Other DBs NCBI-GeneID:  102952857 NCBI-ProteinID:  XP_007073612 LinkDB All DBs Position Un AA seq 90 aa AA seqDB search MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIHESPQPLLQDITYLRIPVADTPE VPIKKHFKECINFIHCCRLNGGNCLVHWIS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggggaatggcatgaccaaggtacttcctggactctacctcggaaacttcattgatgcc aaagacccggaccagctgggccggaataagatcacacacatcatctccatccacgagtca ccccagcctctgctgcaggacataacctaccttcgcatccctgtggcagacacccctgag gtacccatcaaaaagcacttcaaagaatgtatcaacttcatccactgttgccgcctcaat ggggggaactgccttgtgcattggatctcctag

DBGET integrated database retrieval system