Panthera tigris altaica (Amur tiger): 102952942 Help Entry 102952942         CDS       T02988                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     102952942 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102952942 (GAST) Cytokines and neuropeptides [BR:ptg04052]  Neuropeptides   Neuropeptides (GPCR binding)    102952942 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102952942 NCBI-ProteinID:  XP_007087706 UniProt:  A0A8C9J715 LinkDB All DBs Position Un AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAFSEASWKPRSQLQDAPSGPGANRGLEPHWLNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgaccgccttctctgaa gcttcctggaagccccgctcccagctgcaggatgcaccctcgggtccaggggccaacagg ggcctggaaccacattggctgaaccggctgggcccggcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcatacggatggatggacttcggccgccgcagtgcagaggacggg gaccaacatccctag

DBGET integrated database retrieval system