KEGG   Panthera tigris altaica (Amur tiger): 102952980
Entry
102952980         CDS       T02988                                 
Symbol
NRAS
Name
(RefSeq) neuroblastoma RAS viral oncogene homolog
  KO
K07828  GTPase NRas
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04062  Chemokine signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04137  Mitophagy - animal
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04371  Apelin signaling pathway
ptg04540  Gap junction
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04714  Thermogenesis
ptg04720  Long-term potentiation
ptg04722  Neurotrophin signaling pathway
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04730  Long-term depression
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04926  Relaxin signaling pathway
ptg04929  GnRH secretion
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05034  Alcoholism
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05207  Chemical carcinogenesis - receptor activation
ptg05208  Chemical carcinogenesis - reactive oxygen species
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05216  Thyroid cancer
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102952980 (NRAS)
   04012 ErbB signaling pathway
    102952980 (NRAS)
   04014 Ras signaling pathway
    102952980 (NRAS)
   04015 Rap1 signaling pathway
    102952980 (NRAS)
   04370 VEGF signaling pathway
    102952980 (NRAS)
   04371 Apelin signaling pathway
    102952980 (NRAS)
   04068 FoxO signaling pathway
    102952980 (NRAS)
   04072 Phospholipase D signaling pathway
    102952980 (NRAS)
   04071 Sphingolipid signaling pathway
    102952980 (NRAS)
   04151 PI3K-Akt signaling pathway
    102952980 (NRAS)
   04150 mTOR signaling pathway
    102952980 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102952980 (NRAS)
   04137 Mitophagy - animal
    102952980 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    102952980 (NRAS)
   04218 Cellular senescence
    102952980 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102952980 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    102952980 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102952980 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102952980 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    102952980 (NRAS)
   04660 T cell receptor signaling pathway
    102952980 (NRAS)
   04662 B cell receptor signaling pathway
    102952980 (NRAS)
   04664 Fc epsilon RI signaling pathway
    102952980 (NRAS)
   04062 Chemokine signaling pathway
    102952980 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102952980 (NRAS)
   04929 GnRH secretion
    102952980 (NRAS)
   04912 GnRH signaling pathway
    102952980 (NRAS)
   04915 Estrogen signaling pathway
    102952980 (NRAS)
   04917 Prolactin signaling pathway
    102952980 (NRAS)
   04921 Oxytocin signaling pathway
    102952980 (NRAS)
   04926 Relaxin signaling pathway
    102952980 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    102952980 (NRAS)
   04919 Thyroid hormone signaling pathway
    102952980 (NRAS)
   04916 Melanogenesis
    102952980 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    102952980 (NRAS)
   04726 Serotonergic synapse
    102952980 (NRAS)
   04720 Long-term potentiation
    102952980 (NRAS)
   04730 Long-term depression
    102952980 (NRAS)
   04722 Neurotrophin signaling pathway
    102952980 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    102952980 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    102952980 (NRAS)
   04213 Longevity regulating pathway - multiple species
    102952980 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    102952980 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102952980 (NRAS)
   05206 MicroRNAs in cancer
    102952980 (NRAS)
   05205 Proteoglycans in cancer
    102952980 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    102952980 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    102952980 (NRAS)
   05203 Viral carcinogenesis
    102952980 (NRAS)
   05230 Central carbon metabolism in cancer
    102952980 (NRAS)
   05231 Choline metabolism in cancer
    102952980 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102952980 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102952980 (NRAS)
   05225 Hepatocellular carcinoma
    102952980 (NRAS)
   05226 Gastric cancer
    102952980 (NRAS)
   05214 Glioma
    102952980 (NRAS)
   05216 Thyroid cancer
    102952980 (NRAS)
   05221 Acute myeloid leukemia
    102952980 (NRAS)
   05220 Chronic myeloid leukemia
    102952980 (NRAS)
   05218 Melanoma
    102952980 (NRAS)
   05211 Renal cell carcinoma
    102952980 (NRAS)
   05219 Bladder cancer
    102952980 (NRAS)
   05215 Prostate cancer
    102952980 (NRAS)
   05213 Endometrial cancer
    102952980 (NRAS)
   05224 Breast cancer
    102952980 (NRAS)
   05223 Non-small cell lung cancer
    102952980 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102952980 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    102952980 (NRAS)
   05161 Hepatitis B
    102952980 (NRAS)
   05160 Hepatitis C
    102952980 (NRAS)
   05163 Human cytomegalovirus infection
    102952980 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102952980 (NRAS)
   05165 Human papillomavirus infection
    102952980 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102952980 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    102952980 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    102952980 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102952980 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102952980 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102952980 (NRAS)
   01522 Endocrine resistance
    102952980 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102952980 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102952980 (NRAS)
   04031 GTP-binding proteins [BR:ptg04031]
    102952980 (NRAS)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    102952980 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    102952980 (NRAS)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102952980 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102952980 (NRAS)
  Exosomal proteins of breast cancer cells
   102952980 (NRAS)
  Exosomal proteins of colorectal cancer cells
   102952980 (NRAS)
GTP-binding proteins [BR:ptg04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    102952980 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 102952980
NCBI-ProteinID: XP_007076403
UniProt: A0A8C9KGA4
LinkDB
Position
Un
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaacaatagcaaatcatttgcagatattaacctttacagggaacagatt
aagcgagtaaaagactccgatgacgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggaccgtcgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttaccgtgtgtggtgatgtaa

DBGET integrated database retrieval system