Panthera tigris altaica (Amur tiger): 102953018 Help Entry 102953018         CDS       T02988                                  Symbol MLN Name (RefSeq) motilin   KO K05265   motilin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102953018 (MLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102953018 (MLN) Cytokines and neuropeptides [BR:ptg04052]  Neuropeptides   Neuropeptides (GPCR binding)    102953018 (MLN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Motilin_ghrelin DUF3807 Motif Other DBs NCBI-GeneID:  102953018 NCBI-ProteinID:  XP_007085361 UniProt:  A0A8C9JWI1 LinkDB All DBs Position Un AA seq 78 aa AA seqDB search MVSRKAVAVLLMVHVAVMLASQTEAFVPIFTHSELQRIREKERNKGQKKSLIVQQRSEEV GPLDPVEPTEEEENEVIK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggtgtcccgcaaggccgtggctgtcctgctgatggtgcacgtggccgtcatgctggcc tcccagacggaagccttcgttcccatcttcacccacagcgagctccagaggattcgggaa aaggagcggaacaaagggcaaaagaaatccctgattgtacagcagaggtctgaggaagtg ggccctctggaccctgtggagcccacagaagaagaagaaaacgaagttatcaag

DBGET integrated database retrieval system