Panthera tigris altaica (Amur tiger): 102953046 Help Entry 102953046         CDS       T02988                                  Symbol CLDN7 Name (RefSeq) claudin 7   KO K06087   claudin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03272   Virion - Hepatitis viruses ptg04382   Cornified envelope formation ptg04514   Cell adhesion molecules ptg04530   Tight junction ptg04670   Leukocyte transendothelial migration ptg05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102953046 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102953046 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102953046 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102953046 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     102953046 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102953046 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptg03037]     102953046 (CLDN7)    04147 Exosome [BR:ptg04147]     102953046 (CLDN7) Cilium and associated proteins [BR:ptg03037]  Other cilia and associated proteins   Stereociliary proteins    102953046 (CLDN7) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102953046 (CLDN7)   Exosomal proteins of colorectal cancer cells    102953046 (CLDN7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 AlaDh_PNT_C OppC_N Motif Other DBs NCBI-GeneID:  102953046 NCBI-ProteinID:  XP_007091690 LinkDB All DBs Position Un AA seq 128 aa AA seqDB search MVVSLVLGFLAMFVATMGMKCTSCGGDDKVKKARIAMTGGGIFLVAGLAALVACSWYGHQ IVTDFYNPLVPMNLKYEFGPAIFIGWAGSALVILGGALLSCSCPGSESKAGYRAPRSYPK PNSAKEYV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggtggtgtccctggtgctgggcttcctggccatgttcgtggccacgatgggcatgaag tgtacaagctgcgggggagacgacaaagtgaagaaggcccggatagccatgaccggaggc ggcattttcctggtggcaggtcttgctgccttggtagcttgttcctggtatggccaccag attgtcacagacttttataacccgttggtccccatgaatctgaagtacgagttcggtcct gccatcttcattggctgggcggggtcggctctggtcatcctgggaggcgccctcctctct tgctcctgtcccgggagtgagagcaaagctgggtaccgtgcgccccgctcctaccccaag cccaactctgccaaggagtacgtgtga

DBGET integrated database retrieval system