Panthera tigris altaica (Amur tiger): 102953242 Help Entry 102953242         CDS       T02988                                  Symbol CLDN14 Name (RefSeq) claudin 14   KO K06087   claudin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03272   Virion - Hepatitis viruses ptg04382   Cornified envelope formation ptg04514   Cell adhesion molecules ptg04530   Tight junction ptg04670   Leukocyte transendothelial migration ptg05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102953242 (CLDN14)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102953242 (CLDN14)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102953242 (CLDN14)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102953242 (CLDN14)   09158 Development and regeneration    04382 Cornified envelope formation     102953242 (CLDN14)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102953242 (CLDN14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptg03037]     102953242 (CLDN14)    04147 Exosome [BR:ptg04147]     102953242 (CLDN14) Cilium and associated proteins [BR:ptg03037]  Other cilia and associated proteins   Stereociliary proteins    102953242 (CLDN14) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102953242 (CLDN14)   Exosomal proteins of colorectal cancer cells    102953242 (CLDN14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-dskA_traR Motif Other DBs NCBI-GeneID:  102953242 NCBI-ProteinID:  XP_007090553 LinkDB All DBs Position Un AA seq 144 aa AA seqDB search MELRNTRCNAETSKPSSSKSRKMTVVGMKCTRCAKGTPAKTTFAVLGGALFILAGLLCLV AVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQEPAYRPPA AFKDNRAPSATSASLSGYRLNDYV NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggaactaagaaatacccgctgcaatgctgagacatcgaagcccagtagttctaaatcc cgcaagatgacggtggtgggcatgaagtgcacgcgctgcgccaagggcacgcccgccaag accacgtttgccgtgctgggcggcgcgcttttcatcctggccggcctgctctgcctggtg gcggtgtcctggaccaccaacgacgtggtgcagaacttctacaacccgctgctgcccagc ggcatgaagttcgagatcgggcaggccctgtacctcggcttcatctcctcgtccctgtcg ctcatcggcggcacgctgctctgcctgtcctgccaggagcccgcctaccggccccccgcc gccttcaaagacaaccgggccccctcggccacctcggcctcgctcagcgggtacagactg aacgactatgtgtga

DBGET integrated database retrieval system