Panthera tigris altaica (Amur tiger): 102954111 Help Entry 102954111         CDS       T02988                                  Symbol PRCD Name (RefSeq) photoreceptor disc component   KO K19637   progressive rod-cone degeneration protein Organism ptg  Panthera tigris altaica (Amur tiger) Brite KEGG Orthology (KO) [BR:ptg00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptg03037]     102954111 (PRCD) Cilium and associated proteins [BR:ptg03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    102954111 (PRCD) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rod_cone_degen Motif Other DBs NCBI-GeneID:  102954111 NCBI-ProteinID:  XP_007091345 UniProt:  A0A8C9KCT1 LinkDB All DBs Position Un AA seq 54 aa AA seqDB search MCTTLFLLSTLAMLWRRRFANRVQPEPSGLDGAVVGSNVDTDLQSSGREKEPLK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgtgcaccaccctcttcctgctcagcaccttggccatgctctggcgccgccggttcgcc aaccgggtccaaccagagcccagcggactcgatggggcggtcgtgggcagcaacgtggac acagacctccagtcctcaggcagggagaaagagcctctgaagtaa

DBGET integrated database retrieval system