Panthera tigris altaica (Amur tiger): 102954404 Help Entry 102954404         CDS       T02988                                  Symbol FKBP1A Name (RefSeq) FK506 binding protein 1A   KO K09568   FK506-binding protein 1 [EC:5.2.1.8] Organism ptg  Panthera tigris altaica (Amur tiger) Brite KEGG Orthology (KO) [BR:ptg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ptg03110]     102954404 (FKBP1A) Enzymes [BR:ptg01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      102954404 (FKBP1A) Chaperones and folding catalysts [BR:ptg03110]  Protein folding catalysts   Peptidyl prolyl isomerase    FKBP     102954404 (FKBP1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FKBP_C Motif Other DBs NCBI-GeneID:  102954404 NCBI-ProteinID:  XP_007073712 LinkDB All DBs Position Un AA seq 88 aa AA seqDB search MLQLPFFTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPD YAYGATGHPGIIPPNATLVFDVELLKLE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgttacaactgccctttttcacagggatgcttgaagatggaaagaaatttgattcctcc cgggacaggaacaagccctttaagtttatgctaggcaagcaggaggtgatccgaggctgg gaagaaggggttgcccagatgagtgtgggtcagagagccaaactgaccatctccccagac tacgcctacggtgccaccggccacccaggcatcatcccaccgaatgccaccctcgtcttt gacgtggagcttctgaaactggaatga

DBGET integrated database retrieval system