Panthera tigris altaica (Amur tiger): 102954572 Help Entry 102954572         CDS       T02988                                  Symbol DEFB1 Name (RefSeq) defensin beta 1   KO K23125   beta-defensin 1 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg02010   ABC transporters ptg05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     102954572 (DEFB1)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     102954572 (DEFB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ptg02000]     102954572 (DEFB1)    03037 Cilium and associated proteins [BR:ptg03037]     102954572 (DEFB1) Transporters [BR:ptg02000]  Other transporters   Pores ion channels [TC:1]    102954572 (DEFB1) Cilium and associated proteins [BR:ptg03037]  Motile cilia and associated proteins   Sperm associated proteins    102954572 (DEFB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Defb50 Motif Other DBs NCBI-GeneID:  102954572 NCBI-ProteinID:  XP_007089280 LinkDB All DBs Position Un AA seq 68 aa AA seqDB search MKALCFLLLALCLLSRLAPGAAFLTGLGQRSDHYICARKGGTCNFSPCPLFTRIDGTCYG GKAKCCMR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaaggctctctgcttcctgctgctggcgctgtgcctcctctcccgcctggccccaggt gctgcctttctcacgggtctcggccagcggtctgaccactacatatgtgccaggaaagga ggaacctgtaacttttctccatgcccactttttaccaggatcgatggcacctgctatggt ggaaaggccaagtgctgcatgcgctga

DBGET integrated database retrieval system