Panthera tigris altaica (Amur tiger): 102954979 Help Entry 102954979         CDS       T02988                                  Symbol DYNLL1 Name (RefSeq) dynein light chain LC8-type 1   KO K10418   dynein light chain LC8-type Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04814   Motor proteins ptg04962   Vasopressin-regulated water reabsorption ptg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptg00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102954979 (DYNLL1)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102954979 (DYNLL1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102954979 (DYNLL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptg03037]     102954979 (DYNLL1)    04812 Cytoskeleton proteins [BR:ptg04812]     102954979 (DYNLL1) Cilium and associated proteins [BR:ptg03037]  Motile cilia and associated proteins   Dynein arm    102954979 (DYNLL1) Cytoskeleton proteins [BR:ptg04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102954979 (DYNLL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  102954979 NCBI-ProteinID:  XP_007093614 UniProt:  A0A8C9M586 LinkDB All DBs Position Un AA seq 89 aa AA seqDB search MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtgtgaccgaaaggccgtgatcaaaaacgccgacatgtcggaggagatgcaacaggac tcggtggagtgtgcgacccaggcattggagaaatacaacatagagaaggacattgcggcc catattaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgtggggagg aacttcggtagttatgtgacacatgaaaccaaacacttcatctacttctacctgggccaa gtggccattcttctgttcaaatctggttaa

DBGET integrated database retrieval system