Panthera tigris altaica (Amur tiger): 102955353 Help Entry 102955353         CDS       T02988                                  Symbol PFN1 Name (RefSeq) profilin 1   KO K05759   profilin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04015   Rap1 signaling pathway ptg04810   Regulation of actin cytoskeleton ptg05014   Amyotrophic lateral sclerosis ptg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102955353 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102955353 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102955353 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102955353 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptg04131]     102955353 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ptg04812]     102955353 (PFN1)    04147 Exosome [BR:ptg04147]     102955353 (PFN1) Membrane trafficking [BR:ptg04131]  Others   Actin-binding proteins    Others     102955353 (PFN1) Cytoskeleton proteins [BR:ptg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102955353 (PFN1) Exosome [BR:ptg04147]  Exosomal proteins   Proteins found in most exosomes    102955353 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102955353 NCBI-ProteinID:  XP_007091696 UniProt:  A0A8C9K5Q7 LinkDB All DBs Position Un AA seq 104 aa AA seqDB search MGASFPFQPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGA PTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgggcgcttcgttccccttccagccagctgaggttggtgtcctggttggcaaagaccgg tcaagttttttcgtgaacgggctgacacttgggggccagaaatgctctgttatccgggac tcgctgctgcaggacggggaatttaccatggatctccgtaccaagagcaccgggggagct cccaccttcaacatcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaa gaaggtgtccacggcgggatgatcaacaagaaatgttatgaaatggcctcccacctgcgg cgttcccagtactga

DBGET integrated database retrieval system