Panthera tigris altaica (Amur tiger): 102956127 Help Entry 102956127         CDS       T02988                                  Symbol NFKBIA Name (RefSeq) NFKB inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04024   cAMP signaling pathway ptg04062   Chemokine signaling pathway ptg04064   NF-kappa B signaling pathway ptg04210   Apoptosis ptg04380   Osteoclast differentiation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04622   RIG-I-like receptor signaling pathway ptg04623   Cytosolic DNA-sensing pathway ptg04625   C-type lectin receptor signaling pathway ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04662   B cell receptor signaling pathway ptg04668   TNF signaling pathway ptg04722   Neurotrophin signaling pathway ptg04920   Adipocytokine signaling pathway ptg04926   Relaxin signaling pathway ptg04931   Insulin resistance ptg04936   Alcoholic liver disease ptg05132   Salmonella infection ptg05134   Legionellosis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05145   Toxoplasmosis ptg05160   Hepatitis C ptg05161   Hepatitis B ptg05162   Measles ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05166   Human T-cell leukemia virus 1 infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05200   Pathways in cancer ptg05203   Viral carcinogenesis ptg05208   Chemical carcinogenesis - reactive oxygen species ptg05215   Prostate cancer ptg05220   Chronic myeloid leukemia ptg05222   Small cell lung cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ptg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102956127 (NFKBIA)    04668 TNF signaling pathway     102956127 (NFKBIA)    04024 cAMP signaling pathway     102956127 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102956127 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102956127 (NFKBIA)    04621 NOD-like receptor signaling pathway     102956127 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     102956127 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     102956127 (NFKBIA)    04625 C-type lectin receptor signaling pathway     102956127 (NFKBIA)    04660 T cell receptor signaling pathway     102956127 (NFKBIA)    04658 Th1 and Th2 cell differentiation     102956127 (NFKBIA)    04659 Th17 cell differentiation     102956127 (NFKBIA)    04657 IL-17 signaling pathway     102956127 (NFKBIA)    04662 B cell receptor signaling pathway     102956127 (NFKBIA)    04062 Chemokine signaling pathway     102956127 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102956127 (NFKBIA)    04926 Relaxin signaling pathway     102956127 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102956127 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     102956127 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102956127 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     102956127 (NFKBIA)    05203 Viral carcinogenesis     102956127 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102956127 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     102956127 (NFKBIA)    05215 Prostate cancer     102956127 (NFKBIA)    05222 Small cell lung cancer     102956127 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102956127 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     102956127 (NFKBIA)    05161 Hepatitis B     102956127 (NFKBIA)    05160 Hepatitis C     102956127 (NFKBIA)    05171 Coronavirus disease - COVID-19     102956127 (NFKBIA)    05164 Influenza A     102956127 (NFKBIA)    05162 Measles     102956127 (NFKBIA)    05168 Herpes simplex virus 1 infection     102956127 (NFKBIA)    05163 Human cytomegalovirus infection     102956127 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     102956127 (NFKBIA)    05169 Epstein-Barr virus infection     102956127 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102956127 (NFKBIA)    05135 Yersinia infection     102956127 (NFKBIA)    05134 Legionellosis     102956127 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102956127 (NFKBIA)    05140 Leishmaniasis     102956127 (NFKBIA)    05142 Chagas disease     102956127 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102956127 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102956127 (NFKBIA)    04931 Insulin resistance     102956127 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ptg03000]     102956127 (NFKBIA)    04131 Membrane trafficking [BR:ptg04131]     102956127 (NFKBIA) Transcription factors [BR:ptg03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     102956127 (NFKBIA) Membrane trafficking [BR:ptg04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102956127 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  102956127 NCBI-ProteinID:  XP_007073791 LinkDB All DBs Position Un AA seq 253 aa AA seqDB search MHSAALGVFPSLTLRFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVIT NQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATNY NGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCGA DVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELP YDDCVLGGQRLTL NT seq 762 nt NT seq  +upstreamnt  +downstreamnt atgcactcagcggccctgggggtttttccctctcttacccttaggttcctgcacttggcc atcatccatgaagagaaggcattgaccatggaagtggtccgccaagtgaaaggagacctg gccttcctcaatttccagaacaacctgcagcagactccactccacttggctgtgatcacc aaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccgagac tttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtggga gtcctgactcagacctgcaggacccagcacctctactccatcctgcaggccaccaactac aatggtcacacatgtctacacttagcctctatccatggctacctgggcatcgtggagctt ttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgccctc catcttgcagtggacctgcagaattccgacctcgtgtcgcttttgttgaagtgtggggct gatgtcaacagagtcacctaccaaggctactccccgtaccagctcacttggggccgccca agtacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctgcca gagagcgaggatgaggagagctacgacacggagtcagagttcacagaggacgagctgccc tatgatgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system