Panthera tigris altaica (Amur tiger): 102957506 Help Entry 102957506         CDS       T02988                                  Symbol IL2 Name (RefSeq) interleukin 2   KO K05429   interleukin 2 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04060   Cytokine-cytokine receptor interaction ptg04061   Viral protein interaction with cytokine and cytokine receptor ptg04151   PI3K-Akt signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04630   JAK-STAT signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04672   Intestinal immune network for IgA production ptg04940   Type I diabetes mellitus ptg05135   Yersinia infection ptg05142   Chagas disease ptg05162   Measles ptg05166   Human T-cell leukemia virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05200   Pathways in cancer ptg05320   Autoimmune thyroid disease ptg05321   Inflammatory bowel disease ptg05330   Allograft rejection ptg05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102957506 (IL2)    04151 PI3K-Akt signaling pathway     102957506 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102957506 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     102957506 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102957506 (IL2)    04660 T cell receptor signaling pathway     102957506 (IL2)    04658 Th1 and Th2 cell differentiation     102957506 (IL2)    04659 Th17 cell differentiation     102957506 (IL2)    04672 Intestinal immune network for IgA production     102957506 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102957506 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102957506 (IL2)    05171 Coronavirus disease - COVID-19     102957506 (IL2)    05162 Measles     102957506 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     102957506 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     102957506 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     102957506 (IL2)    05321 Inflammatory bowel disease     102957506 (IL2)    05330 Allograft rejection     102957506 (IL2)    05332 Graft-versus-host disease     102957506 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102957506 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102957506 (IL2)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102957506 (IL2) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Interleukins    102957506 (IL2) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Cytokines    102957506 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Leg1 Motif Other DBs NCBI-GeneID:  102957506 NCBI-ProteinID:  XP_007087656 UniProt:  A0A8C9JG55 LinkDB All DBs Position Un AA seq 154 aa AA seqDB search MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS ETRFTCKYDDETATIVEFLNKWITFCQSIFSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc acgtttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct gaaacaagattcacatgtaaatatgatgatgagacagcaaccattgtagaatttctgaac aaatggattaccttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system