Panthera tigris altaica (Amur tiger): 102957626 Help Entry 102957626         CDS       T02988                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03082   ATP-dependent chromatin remodeling ptg04217   Necroptosis ptg04613   Neutrophil extracellular trap formation ptg05034   Alcoholism ptg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102957626  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102957626  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102957626  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     102957626   09165 Substance dependence    05034 Alcoholism     102957626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102957626   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102957626 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102957626 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102957626 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102957626 NCBI-ProteinID:  XP_007074525 LinkDB All DBs Position Un AA seq 143 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKATQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtctgggcgcgggaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctgcagttcccggtggggcgcgtgcaccgcctgctccgcaagggcaactac gccgagcgggtcggggccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtcaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaaa accagcgccaccgtggggccgaaggcgccggcgggcggcaagaaggccacccaggcctct caggagtactga

DBGET integrated database retrieval system