Panthera tigris altaica (Amur tiger): 102958442 Help Entry 102958442         CDS       T02988                                  Symbol FAS Name (RefSeq) Fas cell surface death receptor   KO K04390   tumor necrosis factor receptor superfamily member 6 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01524   Platinum drug resistance ptg04010   MAPK signaling pathway ptg04060   Cytokine-cytokine receptor interaction ptg04115   p53 signaling pathway ptg04210   Apoptosis ptg04217   Necroptosis ptg04650   Natural killer cell mediated cytotoxicity ptg04668   TNF signaling pathway ptg04932   Non-alcoholic fatty liver disease ptg04936   Alcoholic liver disease ptg04940   Type I diabetes mellitus ptg05010   Alzheimer disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05142   Chagas disease ptg05143   African trypanosomiasis ptg05160   Hepatitis C ptg05161   Hepatitis B ptg05162   Measles ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05165   Human papillomavirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer ptg05205   Proteoglycans in cancer ptg05320   Autoimmune thyroid disease ptg05330   Allograft rejection ptg05332   Graft-versus-host disease ptg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102958442 (FAS)    04668 TNF signaling pathway     102958442 (FAS)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102958442 (FAS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102958442 (FAS)    04217 Necroptosis     102958442 (FAS)    04115 p53 signaling pathway     102958442 (FAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102958442 (FAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102958442 (FAS)    05205 Proteoglycans in cancer     102958442 (FAS)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102958442 (FAS)    05161 Hepatitis B     102958442 (FAS)    05160 Hepatitis C     102958442 (FAS)    05164 Influenza A     102958442 (FAS)    05162 Measles     102958442 (FAS)    05168 Herpes simplex virus 1 infection     102958442 (FAS)    05163 Human cytomegalovirus infection     102958442 (FAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102958442 (FAS)    05169 Epstein-Barr virus infection     102958442 (FAS)    05165 Human papillomavirus infection     102958442 (FAS)   09174 Infectious disease: parasitic    05142 Chagas disease     102958442 (FAS)    05143 African trypanosomiasis     102958442 (FAS)   09163 Immune disease    05320 Autoimmune thyroid disease     102958442 (FAS)    05330 Allograft rejection     102958442 (FAS)    05332 Graft-versus-host disease     102958442 (FAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102958442 (FAS)    05022 Pathways of neurodegeneration - multiple diseases     102958442 (FAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102958442 (FAS)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102958442 (FAS)    04936 Alcoholic liver disease     102958442 (FAS)    04932 Non-alcoholic fatty liver disease     102958442 (FAS)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102958442 (FAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04050 Cytokine receptors [BR:ptg04050]     102958442 (FAS)    04090 CD molecules [BR:ptg04090]     102958442 (FAS) Cytokine receptors [BR:ptg04050]  Tumor necrosis factor receptors   TNF receptor superfamily    102958442 (FAS) CD molecules [BR:ptg04090]  Proteins   102958442 (FAS) SSDB OrthologParalogGFIT Motif Pfam:  Death TNFR_c6 Death_3 Motif Other DBs NCBI-GeneID:  102958442 NCBI-ProteinID:  XP_015391744 LinkDB All DBs Position Un AA seq 331 aa AA seqDB search MSKCFRHPCLPRCLVDKSVFAHAFLFQILTSVAGSLFRGDSAQVADVNSKVLKLSKNATE GEPGCKEGLHRGSKFCCLPCSPGTRKAADCEEDGGTASCIPCEEGKDYTDTSHFSPRCRR CRICDGEHGLEVEKACTRTQDTKCRCKSNFFCNVSLCEHCNPCMMCEHGILENCTPTSNT KCKQGSSSKLLWLCALLLILPSALVCCCVLKKYRNTKNGRRRSTVSSTESIPMNFADIDL SKYISSIAEQMKITQVREFVRKNGINEAKIDEIKNDNLQDTAEQKVQLLRNWYQLHGRKG AYYALMKGLRKANLCALAEKIEDMVQKDSAG NT seq 996 nt NT seq  +upstreamnt  +downstreamnt atgtccaaatgcttccgtcacccctgtttaccacgttgcctggttgacaagtcagtgttt gctcatgctttcctttttcagatacttacctctgttgccggatcactgttcagaggcgac agtgctcaggtcgccgatgtcaactccaaggtgttgaaattgagtaagaacgctaccgaa ggggagcctggatgcaaggaaggtctgcatcgtgggagcaagttctgctgtctgccatgc tctcctggcacacgaaaagctgccgactgtgaagaagatgggggtacagcatcctgtata ccctgtgaagaagggaaggactacacagacacgagccatttttctcccagatgcagaaga tgtagaatttgtgatggagagcacggcttagaagtggaaaaagcctgtacccggacccag gataccaagtgcagatgtaaatcaaactttttttgtaacgtctctctgtgtgaacactgt aacccgtgcatgatgtgtgaacatggaatccttgagaattgcacaccaaccagcaacacc aaatgtaaacaaggatccagctccaaacttctgtggctttgtgccctgctcctgattctg ccgtccgcactagtatgttgctgtgtgttgaaaaagtacaggaatacaaagaatggccgc cggagatctacagtctcatctactgagagtatcccaatgaatttcgcagacatcgacttg agtaaatacatcagtagcattgccgaacaaatgaaaataactcaggtcagagaatttgtc cgcaagaacggtatcaacgaagccaaaatagacgagatcaagaacgacaacctccaagac acagctgaacagaaagtccaactgctccggaattggtaccagctccatgggaggaagggc gcatattacgctctgatgaaaggcctcaggaaagccaatctctgcgctcttgccgagaaa attgaagatatggtccagaaggacagtgcgggctaa

DBGET integrated database retrieval system