Panthera tigris altaica (Amur tiger): 102958892 Help Entry 102958892         CDS       T02988                                  Symbol CCL4 Name (RefSeq) C-C motif chemokine 4   KO K12964   C-C motif chemokine 4 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04060   Cytokine-cytokine receptor interaction ptg04061   Viral protein interaction with cytokine and cytokine receptor ptg04062   Chemokine signaling pathway ptg04064   NF-kappa B signaling pathway ptg04620   Toll-like receptor signaling pathway ptg04623   Cytosolic DNA-sensing pathway ptg05163   Human cytomegalovirus infection Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102958892 (CCL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102958892 (CCL4)    04061 Viral protein interaction with cytokine and cytokine receptor     102958892 (CCL4)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102958892 (CCL4)    04623 Cytosolic DNA-sensing pathway     102958892 (CCL4)    04062 Chemokine signaling pathway     102958892 (CCL4)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102958892 (CCL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102958892 (CCL4) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Chemokines    102958892 (CCL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102958892 NCBI-ProteinID:  XP_007096100 UniProt:  A0A8C9K3P2 LinkDB All DBs Position Un AA seq 92 aa AA seqDB search MKLCVTVLSLLVLVAAFCSPTLSAPMGSDPPTACCFSYVLRKLPRNFVVDYFETSSLCSQ PAVVFQTKRGRQVCANPSDSWVQEYMDDLELN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaactctgtgtgactgtcctttctctccttgtgctagtggctgccttctgctccccg acgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttctcttacgtcctg cggaagctccctcgaaactttgtagtggattactttgagaccagcagcctctgctcccag ccagctgtggtattccaaaccaaaaggggcagacaagtctgtgctaaccccagtgactcc tgggtccaggaatacatggatgacctggaactgaattga

DBGET integrated database retrieval system