Panthera tigris altaica (Amur tiger): 102959514 Help Entry 102959514         CDS       T02988                                  Symbol CFL2 Name (RefSeq) cofilin 2   KO K05765   cofilin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04360   Axon guidance ptg04666   Fc gamma R-mediated phagocytosis ptg04810   Regulation of actin cytoskeleton ptg05133   Pertussis ptg05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:ptg00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102959514 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102959514 (CFL2)   09158 Development and regeneration    04360 Axon guidance     102959514 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102959514 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     102959514 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptg04131]     102959514 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ptg04812]     102959514 (CFL2)    04147 Exosome [BR:ptg04147]     102959514 (CFL2) Membrane trafficking [BR:ptg04131]  Others   Actin-binding proteins    Others     102959514 (CFL2) Cytoskeleton proteins [BR:ptg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      102959514 (CFL2) Exosome [BR:ptg04147]  Exosomal proteins   Proteins found in most exosomes    102959514 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  102959514 NCBI-ProteinID:  XP_007073803 UniProt:  A0A8C9J2T3 LinkDB All DBs Position Un AA seq 149 aa AA seqDB search MKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPL NDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQV NGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtaagaaaatcttctacacaagaggagatcaaaaaaagaaagaaagccgttctc ttctgtttaagcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtg ggtgacattggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctg aatgattgccgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaa gacctagtatttatattctgggctcctgagagtgcacctttaaaaagcaagatgatttat gctagctctaaagatgccattaaaaagaaatttacaggtattaaacatgaatggcaagta aatggcttggatgatataaaggaccgttcaacacttggagagaaattgggaggcaacgta gtagtttcacttgaaggaaaacccttataa

DBGET integrated database retrieval system