Panthera tigris altaica (Amur tiger): 102960385 Help Entry 102960385         CDS       T02988                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04613   Neutrophil extracellular trap formation ptg05034   Alcoholism ptg05203   Viral carcinogenesis ptg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102960385  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102960385   09163 Immune disease    05322 Systemic lupus erythematosus     102960385   09165 Substance dependence    05034 Alcoholism     102960385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102960385   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102960385 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102960385 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102960385 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102960385 NCBI-ProteinID:  XP_007074533 UniProt:  A0A8C9J386 LinkDB All DBs Position Un AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagcccgcgaagtccgccccggccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtag

DBGET integrated database retrieval system