KEGG   Panthera tigris altaica (Amur tiger): 102960590
Entry
102960590         CDS       T02988                                 
Symbol
MAPK11
Name
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04015  Rap1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04114  Oocyte meiosis
ptg04148  Efferocytosis
ptg04218  Cellular senescence
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04517  IgSF CAM signaling
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04668  TNF signaling pathway
ptg04670  Leukocyte transendothelial migration
ptg04714  Thermogenesis
ptg04722  Neurotrophin signaling pathway
ptg04723  Retrograde endocannabinoid signaling
ptg04728  Dopaminergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04912  GnRH signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04917  Prolactin signaling pathway
ptg04926  Relaxin signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg04936  Alcoholic liver disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05205  Proteoglycans in cancer
ptg05208  Chemical carcinogenesis - reactive oxygen species
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05415  Diabetic cardiomyopathy
ptg05417  Lipid and atherosclerosis
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102960590 (MAPK11)
   04015 Rap1 signaling pathway
    102960590 (MAPK11)
   04370 VEGF signaling pathway
    102960590 (MAPK11)
   04668 TNF signaling pathway
    102960590 (MAPK11)
   04068 FoxO signaling pathway
    102960590 (MAPK11)
   04071 Sphingolipid signaling pathway
    102960590 (MAPK11)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102960590 (MAPK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    102960590 (MAPK11)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102960590 (MAPK11)
   04218 Cellular senescence
    102960590 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102960590 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102960590 (MAPK11)
   04613 Neutrophil extracellular trap formation
    102960590 (MAPK11)
   04620 Toll-like receptor signaling pathway
    102960590 (MAPK11)
   04621 NOD-like receptor signaling pathway
    102960590 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    102960590 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    102960590 (MAPK11)
   04660 T cell receptor signaling pathway
    102960590 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    102960590 (MAPK11)
   04659 Th17 cell differentiation
    102960590 (MAPK11)
   04657 IL-17 signaling pathway
    102960590 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    102960590 (MAPK11)
   04670 Leukocyte transendothelial migration
    102960590 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102960590 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    102960590 (MAPK11)
   04917 Prolactin signaling pathway
    102960590 (MAPK11)
   04926 Relaxin signaling pathway
    102960590 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    102960590 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102960590 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    102960590 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    102960590 (MAPK11)
   04722 Neurotrophin signaling pathway
    102960590 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102960590 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102960590 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    102960590 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102960590 (MAPK11)
   05208 Chemical carcinogenesis - reactive oxygen species
    102960590 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102960590 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102960590 (MAPK11)
   05161 Hepatitis B
    102960590 (MAPK11)
   05171 Coronavirus disease - COVID-19
    102960590 (MAPK11)
   05163 Human cytomegalovirus infection
    102960590 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102960590 (MAPK11)
   05169 Epstein-Barr virus infection
    102960590 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102960590 (MAPK11)
   05135 Yersinia infection
    102960590 (MAPK11)
   05133 Pertussis
    102960590 (MAPK11)
   05152 Tuberculosis
    102960590 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102960590 (MAPK11)
   05140 Leishmaniasis
    102960590 (MAPK11)
   05142 Chagas disease
    102960590 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102960590 (MAPK11)
   05020 Prion disease
    102960590 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    102960590 (MAPK11)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102960590 (MAPK11)
   05418 Fluid shear stress and atherosclerosis
    102960590 (MAPK11)
   05415 Diabetic cardiomyopathy
    102960590 (MAPK11)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    102960590 (MAPK11)
   04932 Non-alcoholic fatty liver disease
    102960590 (MAPK11)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102960590 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102960590 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102960590 (MAPK11)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102960590 (MAPK11)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102960590 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Cas_CT1975
Other DBs
NCBI-GeneID: 102960590
NCBI-ProteinID: XP_007094103
LinkDB
Position
Un
AA seq 186 aa
MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEV
VGTPSPEVLAKISSEHARTYIQSLPPMPQKDLRSIFRGANPLAVDLLGRMLVLDSDQRVS
AAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQSPG
SLDIEQ
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaccggctatgtggccacccgctggtaccgcgcacctgagatcatgctcaactggatg
cactacaaccagacagtggacatctggtctgtgggctgcatcatggctgagctgctccag
ggaaaggccctcttcccaggaaatgactacatcgaccagctgaagcgaatcatggaggtg
gtgggcacgcccagccctgaggttctagcaaaaatatcatcggaacacgcccggacatac
atccagtccctgccccccatgccccagaaggacctcaggagcatcttccgtggagccaac
cccctggctgtggatctcctgggaaggatgctggtgctggacagtgaccagagggtcagt
gcggccgaggccctggcccatgcctacttcagccagtaccacgaccccgacgatgagccc
gaggctgagccctatgatgaaagcgttgaggccaaggagcggaccgtggaggagtggaag
gagctcacctaccaggaggtcctcagcttcaagcccccggagccaccgcagtcacctggc
agcctggatattgagcagtga

DBGET integrated database retrieval system