Panthera tigris altaica (Amur tiger): 102960781 Help Entry 102960781         CDS       T02988                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine ligand 5   KO K12499   C-C motif chemokine 5 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04060   Cytokine-cytokine receptor interaction ptg04061   Viral protein interaction with cytokine and cytokine receptor ptg04062   Chemokine signaling pathway ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04623   Cytosolic DNA-sensing pathway ptg04668   TNF signaling pathway ptg05020   Prion disease ptg05142   Chagas disease ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05168   Herpes simplex virus 1 infection ptg05323   Rheumatoid arthritis ptg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102960781 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102960781 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     102960781 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102960781 (CCL5)    04621 NOD-like receptor signaling pathway     102960781 (CCL5)    04623 Cytosolic DNA-sensing pathway     102960781 (CCL5)    04062 Chemokine signaling pathway     102960781 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102960781 (CCL5)    05168 Herpes simplex virus 1 infection     102960781 (CCL5)    05163 Human cytomegalovirus infection     102960781 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     102960781 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     102960781 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     102960781 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102960781 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102960781 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102960781 (CCL5) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Chemokines    102960781 (CCL5) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Chemokines    102960781 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102960781 NCBI-ProteinID:  XP_007096106 UniProt:  A0A8C9MA66 LinkDB All DBs Position Un AA seq 91 aa AA seqDB search MKVSPAAFAVLLTAAAFCAPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMP AVVFVTRRKRQVCANPQKKWVRDYINSLEMN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccccagctgcctttgcagtcctcctcactgctgccgctttctgcgctcct gcctctgcatccccatatgcctcggacaccaccccctgttgctttgcctacctctcccac ccactgccgctcacccacctccaggagtatttctacaccagcagcaagtgttccatgcca gcagtcgtctttgtcacccggaggaagcgccaggtgtgtgccaacccacagaagaaatgg gtgcgggactacatcaactctttggagatgaactag

DBGET integrated database retrieval system