Panthera tigris altaica (Amur tiger): 102960961 Help Entry 102960961         CDS       T02988                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04613   Neutrophil extracellular trap formation ptg05034   Alcoholism ptg05203   Viral carcinogenesis ptg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102960961  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102960961   09163 Immune disease    05322 Systemic lupus erythematosus     102960961   09165 Substance dependence    05034 Alcoholism     102960961  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102960961 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102960961 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP Motif Other DBs NCBI-GeneID:  102960961 NCBI-ProteinID:  XP_015396233 LinkDB All DBs Position Un AA seq 134 aa AA seqDB search MAGAIYVPPDSRDSTSSSIFYCFIVGSSKYESLLKVTHRSCVGKGGAKRHRKVLRDNIQG ITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVY ALKRQGRTLYGFGG NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggctggtgccatctacgtgcccccagactcccgtgattctacctccagctccatcttt tactgctttatagttggaagttccaagtatgaatcactgttaaaagtgacacatcgatca tgcgtgggcaaggggggcgcaaagcgccaccgcaaggtgctgcgcgacaacatccagggc atcacgaagcccgccatccggcggctggcccggcgcggcggcgtgaagcgcatctccggc ctcatctacgaggagacccgcggggtgctcaaggtgttcctggagaacgtgatccgggac gccgtcacctacacggagcacgccaagcgcaagacggtcacggccatggacgtggtgtac gcgctcaagcgccagggccgcaccctctacggcttcggaggctga

DBGET integrated database retrieval system