KEGG   Panthera tigris altaica (Amur tiger): 102960964
Entry
102960964         CDS       T02988                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04114  Oocyte meiosis
ptg04140  Autophagy - animal
ptg04148  Efferocytosis
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04218  Cellular senescence
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04350  TGF-beta signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04371  Apelin signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04517  IgSF CAM signaling
ptg04520  Adherens junction
ptg04540  Gap junction
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg04611  Platelet activation
ptg04613  Neutrophil extracellular trap formation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg04668  TNF signaling pathway
ptg04713  Circadian entrainment
ptg04720  Long-term potentiation
ptg04722  Neurotrophin signaling pathway
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04730  Long-term depression
ptg04810  Regulation of actin cytoskeleton
ptg04910  Insulin signaling pathway
ptg04912  GnRH signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04926  Relaxin signaling pathway
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04929  GnRH secretion
ptg04930  Type II diabetes mellitus
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg04960  Aldosterone-regulated sodium reabsorption
ptg05010  Alzheimer disease
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05034  Alcoholism
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05207  Chemical carcinogenesis - receptor activation
ptg05208  Chemical carcinogenesis - reactive oxygen species
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05216  Thyroid cancer
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102960964 (MAPK3)
   04012 ErbB signaling pathway
    102960964 (MAPK3)
   04014 Ras signaling pathway
    102960964 (MAPK3)
   04015 Rap1 signaling pathway
    102960964 (MAPK3)
   04350 TGF-beta signaling pathway
    102960964 (MAPK3)
   04370 VEGF signaling pathway
    102960964 (MAPK3)
   04371 Apelin signaling pathway
    102960964 (MAPK3)
   04668 TNF signaling pathway
    102960964 (MAPK3)
   04066 HIF-1 signaling pathway
    102960964 (MAPK3)
   04068 FoxO signaling pathway
    102960964 (MAPK3)
   04072 Phospholipase D signaling pathway
    102960964 (MAPK3)
   04071 Sphingolipid signaling pathway
    102960964 (MAPK3)
   04024 cAMP signaling pathway
    102960964 (MAPK3)
   04022 cGMP-PKG signaling pathway
    102960964 (MAPK3)
   04151 PI3K-Akt signaling pathway
    102960964 (MAPK3)
   04150 mTOR signaling pathway
    102960964 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102960964 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102960964 (MAPK3)
   04148 Efferocytosis
    102960964 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102960964 (MAPK3)
   04210 Apoptosis
    102960964 (MAPK3)
   04218 Cellular senescence
    102960964 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102960964 (MAPK3)
   04520 Adherens junction
    102960964 (MAPK3)
   04540 Gap junction
    102960964 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102960964 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102960964 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102960964 (MAPK3)
   04613 Neutrophil extracellular trap formation
    102960964 (MAPK3)
   04620 Toll-like receptor signaling pathway
    102960964 (MAPK3)
   04621 NOD-like receptor signaling pathway
    102960964 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    102960964 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    102960964 (MAPK3)
   04660 T cell receptor signaling pathway
    102960964 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    102960964 (MAPK3)
   04659 Th17 cell differentiation
    102960964 (MAPK3)
   04657 IL-17 signaling pathway
    102960964 (MAPK3)
   04662 B cell receptor signaling pathway
    102960964 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    102960964 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    102960964 (MAPK3)
   04062 Chemokine signaling pathway
    102960964 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102960964 (MAPK3)
   04929 GnRH secretion
    102960964 (MAPK3)
   04912 GnRH signaling pathway
    102960964 (MAPK3)
   04915 Estrogen signaling pathway
    102960964 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    102960964 (MAPK3)
   04917 Prolactin signaling pathway
    102960964 (MAPK3)
   04921 Oxytocin signaling pathway
    102960964 (MAPK3)
   04926 Relaxin signaling pathway
    102960964 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    102960964 (MAPK3)
   04919 Thyroid hormone signaling pathway
    102960964 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    102960964 (MAPK3)
   04916 Melanogenesis
    102960964 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102960964 (MAPK3)
   04270 Vascular smooth muscle contraction
    102960964 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102960964 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102960964 (MAPK3)
   04725 Cholinergic synapse
    102960964 (MAPK3)
   04726 Serotonergic synapse
    102960964 (MAPK3)
   04720 Long-term potentiation
    102960964 (MAPK3)
   04730 Long-term depression
    102960964 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    102960964 (MAPK3)
   04722 Neurotrophin signaling pathway
    102960964 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    102960964 (MAPK3)
   04380 Osteoclast differentiation
    102960964 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102960964 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102960964 (MAPK3)
   05206 MicroRNAs in cancer
    102960964 (MAPK3)
   05205 Proteoglycans in cancer
    102960964 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    102960964 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    102960964 (MAPK3)
   05203 Viral carcinogenesis
    102960964 (MAPK3)
   05230 Central carbon metabolism in cancer
    102960964 (MAPK3)
   05231 Choline metabolism in cancer
    102960964 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102960964 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102960964 (MAPK3)
   05212 Pancreatic cancer
    102960964 (MAPK3)
   05225 Hepatocellular carcinoma
    102960964 (MAPK3)
   05226 Gastric cancer
    102960964 (MAPK3)
   05214 Glioma
    102960964 (MAPK3)
   05216 Thyroid cancer
    102960964 (MAPK3)
   05221 Acute myeloid leukemia
    102960964 (MAPK3)
   05220 Chronic myeloid leukemia
    102960964 (MAPK3)
   05218 Melanoma
    102960964 (MAPK3)
   05211 Renal cell carcinoma
    102960964 (MAPK3)
   05219 Bladder cancer
    102960964 (MAPK3)
   05215 Prostate cancer
    102960964 (MAPK3)
   05213 Endometrial cancer
    102960964 (MAPK3)
   05224 Breast cancer
    102960964 (MAPK3)
   05223 Non-small cell lung cancer
    102960964 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102960964 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    102960964 (MAPK3)
   05161 Hepatitis B
    102960964 (MAPK3)
   05160 Hepatitis C
    102960964 (MAPK3)
   05171 Coronavirus disease - COVID-19
    102960964 (MAPK3)
   05164 Influenza A
    102960964 (MAPK3)
   05163 Human cytomegalovirus infection
    102960964 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102960964 (MAPK3)
   05165 Human papillomavirus infection
    102960964 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102960964 (MAPK3)
   05135 Yersinia infection
    102960964 (MAPK3)
   05133 Pertussis
    102960964 (MAPK3)
   05152 Tuberculosis
    102960964 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102960964 (MAPK3)
   05140 Leishmaniasis
    102960964 (MAPK3)
   05142 Chagas disease
    102960964 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102960964 (MAPK3)
   05020 Prion disease
    102960964 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    102960964 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    102960964 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102960964 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102960964 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102960964 (MAPK3)
   04934 Cushing syndrome
    102960964 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102960964 (MAPK3)
   01524 Platinum drug resistance
    102960964 (MAPK3)
   01522 Endocrine resistance
    102960964 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102960964 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptg03036]
    102960964 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102960964 (MAPK3)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102960964 (MAPK3)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102960964 (MAPK3)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102960964 (MAPK3)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102960964 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102960964
NCBI-ProteinID: XP_015398074
LinkDB
Position
Un
AA seq 361 aa
LGQNPLLLPPLPAQAWVGPPGLDSPDVRPHRPHLSGPLSSAYDHVRKTRVAIKKISPFEH
QTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQL
SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDAKALDLLDRMLTFNPNKR
ITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGALEA
P
NT seq 1086 nt   +upstreamnt  +downstreamnt
cttggccagaatcctctcttgctccctcccctccctgctcaggcctgggtggggccccca
ggcctggactcccccgatgtaaggccacaccgaccacatctctctggccccctcagctca
gcttatgaccacgtgcgcaagactcgcgtggccatcaagaaaatcagccccttcgagcat
cagacctactgccagcgcacgctgcgggagatccagatcctgctgcgcttccgccatgag
aacgtcattggcatccgggacattctgcgggcgcccaccctggaagccatgagggatgtc
tacattgtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctg
agcaacgaccacatttgctacttcctctaccagatcctgcggggcctcaagtatatccac
tcagccaacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgc
gaccttaagatctgtgattttggcctggcccggattgccgatcctgagcatgaccacact
ggcttcctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaac
tccaagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatg
ctctccaacaggcccatcttccctggcaagcactacctggaccagctcaaccacattctg
gggatcctgggctccccatcccaggaggacttgaattgtatcatcaacatgaaggcccga
aactacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaag
tcagatgccaaagccctggatctgctagaccggatgttgacctttaaccccaacaaacgg
atcacagtggaggaagcactggctcacccctacctggagcagtactacgacccaacggat
gagccagtggccgaggagcctttcaccttcgacatggagctggatgatctacccaaggag
cggctgaaggagctcatcttccaggagacagcccgcttccagcctggggcactggaggcc
ccctaa

DBGET integrated database retrieval system