Panthera tigris altaica (Amur tiger): 102961657 Help Entry 102961657         CDS       T02988                                  Symbol DAD1 Name (RefSeq) defender against cell death 1   KO K12668   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit DAD1/OST2 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg00510   N-Glycan biosynthesis ptg00513   Various types of N-glycan biosynthesis ptg01100   Metabolic pathways ptg04141   Protein processing in endoplasmic reticulum Module ptg_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ptg00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     102961657 (DAD1)    00513 Various types of N-glycan biosynthesis     102961657 (DAD1)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102961657 (DAD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DAD Motif Other DBs NCBI-GeneID:  102961657 NCBI-ProteinID:  XP_007098008 UniProt:  A0A8C9J5W5 LinkDB All DBs Position Un AA seq 113 aa AA seqDB search MSASVVSVILRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtcggcgtcggtagtgtccgtcatcttgcggttcttagaagagtacttgagctccact cctcagcgtctgaagttgcttgacgcgtacctcctgtacatactgctgaccggggcgctg cagttcggttattgcctcctcgtggggaccttccccttcaactcttttctctcgggcttc atctcttgtgtggggagcttcatcctagcggtttgcctcaggatacagatcaacccacag aacaaagcggatttccaaggcatctccccagaacgagcttttgctgattttctctttgcc agcaccatcctgcaccttgttgtaatgaactttgttggctga

DBGET integrated database retrieval system