Panthera tigris altaica (Amur tiger): 102961966 Help Entry 102961966         CDS       T02988                                  Symbol S100A10 Name (RefSeq) S100 calcium binding protein A10   KO K17274   protein S100-A10 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04382   Cornified envelope formation ptg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     102961966 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102961966 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102961966 (S100A10) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of microglial cells    102961966 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  102961966 NCBI-ProteinID:  XP_007088210 UniProt:  A0A8C9JTG2 LinkDB All DBs Position Un AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaacgatgatgttcacgttccacaagtttgct ggggacaaaggctacctaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccccctggctgtggacaagataatgaaggacctagac cagtgccgggacggcagagtgggtttccagagcttcttttcgctgattgctgggctcacc atcgcatgcaatgactattttgtagttcacatgaagcagaaaggaaagaagtag

DBGET integrated database retrieval system