Panthera tigris altaica (Amur tiger): 102962277 Help Entry 102962277         CDS       T02988                                  Symbol WNT1 Name (RefSeq) Wnt family member 1   KO K03209   wingless-type MMTV integration site family, member 1 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04150   mTOR signaling pathway ptg04310   Wnt signaling pathway ptg04390   Hippo signaling pathway ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04916   Melanogenesis ptg04934   Cushing syndrome ptg05010   Alzheimer disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05165   Human papillomavirus infection ptg05200   Pathways in cancer ptg05205   Proteoglycans in cancer ptg05207   Chemical carcinogenesis - receptor activation ptg05217   Basal cell carcinoma ptg05224   Breast cancer ptg05225   Hepatocellular carcinoma ptg05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102962277 (WNT1)    04390 Hippo signaling pathway     102962277 (WNT1)    04150 mTOR signaling pathway     102962277 (WNT1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102962277 (WNT1)  09150 Organismal Systems   09152 Endocrine system    04916 Melanogenesis     102962277 (WNT1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102962277 (WNT1)    05205 Proteoglycans in cancer     102962277 (WNT1)    05207 Chemical carcinogenesis - receptor activation     102962277 (WNT1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102962277 (WNT1)    05226 Gastric cancer     102962277 (WNT1)    05217 Basal cell carcinoma     102962277 (WNT1)    05224 Breast cancer     102962277 (WNT1)   09172 Infectious disease: viral    05165 Human papillomavirus infection     102962277 (WNT1)   09164 Neurodegenerative disease    05010 Alzheimer disease     102962277 (WNT1)    05022 Pathways of neurodegeneration - multiple diseases     102962277 (WNT1)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102962277 (WNT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102962277 (WNT1) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Morphogens    102962277 (WNT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  wnt DUF6973 Motif Other DBs NCBI-GeneID:  102962277 NCBI-ProteinID:  XP_015400289 LinkDB All DBs Position Un AA seq 232 aa AA seqDB search MSNPGPEGPAPTTHLTRGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGI LHSVSGGLQSAVRECKWQFRNRRWNCPTATGPHLFGKIVNRGCRETAFIFAITSAGVTHS VARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLM NLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRI NT seq 699 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaccccgggcccgaaggccccgctcctaccacgcatctcaccaggggcatcgtg aacgtagcctcctccacgaacctgctgaccgactccaagagtctacaactggtgctcgag cccagtcttcagctgctgagccgcaaacagaggaggctgatccgccagaacccggggatc ctgcacagcgtgagcggggggctgcagagcgctgtgcgagagtgcaagtggcagttccgc aaccgccgctggaactgccccacggctacggggccccacctcttcggcaagatcgtcaac cgaggctgtcgggaaacggcgtttattttcgctatcacctccgccggggttacccattcg gtggcgcgctcctgctcagagggctccatcgagtcttgcacgtgcgactatcggcggcgc ggccctgggggccccgattggcactgggggggctgcagcgacaacatcgacttcggccgc ctcttcggcagggagtttgtggactccggggagaaggggcgggacctgcgcttcctcatg aaccttcacaacaacgaggctggccgcacgactgtgttctctgagatgcgccaggagtgc aagtgccacgggatgtcgggctcgtgcacggtgcgcacgtgctggatgcggctgcccacg ctgcgcgccgtgggcgacgtgctgcgcgaccgaatctag

DBGET integrated database retrieval system