Panthera tigris altaica (Amur tiger): 102962372 Help Entry 102962372         CDS       T02988                                  Symbol NPY Name (RefSeq) neuropeptide Y   KO K05232   neuropeptide Y Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04024   cAMP signaling pathway ptg04080   Neuroactive ligand-receptor interaction ptg04920   Adipocytokine signaling pathway ptg04923   Regulation of lipolysis in adipocytes ptg05034   Alcoholism Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102962372 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102962372 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102962372 (NPY)    04920 Adipocytokine signaling pathway     102962372 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     102962372 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102962372 (NPY) Cytokines and neuropeptides [BR:ptg04052]  Neuropeptides   Neuropeptides (GPCR binding)    102962372 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  102962372 NCBI-ProteinID:  XP_007089108 UniProt:  A0A8C9KAJ7 LinkDB All DBs Position Un AA seq 97 aa AA seqDB search MLGSKRLGLSGMTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctgggtagcaagcgactggggctatccggaatgaccctcgccctgtccctgcttgtg tgcctgggcgcgctggccgaggcgtacccctccaagccagacaacccaggagaggacgcg ccggcagaggacatggccagatactattcagcgctgcgacactacatcaacctcatcacc aggcagaggtatggaaaacgatctagccctgagacactgatttcagacctcttgatgaga gaaagcacagaaaacgttcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system